Hey smart people out there, what structure does this protein fold into? Hint: AlphaFold, ESMFold, Boltz, Chai, etc are wrong 🤭. Good luck!

>whatami
MKIAVIGATGQVGREIAKLLAEKGHEVTAIASRSKNPEEVAKLGIEAVYVDGEVLDFKSVEEAVKNADVVISVAGG

AI-Designed Peptides Outperform GLP-1 in Lab 67% of AI-designed peptides outperformed GLP-1 in binding assays vs. ~0.1% for traditional methods. Peptides with 10+ changes delivered the biggest gains showcasing the power of AI creativity.

310 AI model MP4 designed 93 GLP-1R agonists. 67% outperformed the native peptide in experimental testing.
Surprisingly, the more creative the AI got, the greater the activity gains.

bit.ly/ai-glp1

Drugit: crowd-sourcing molecular design of non-peptidic VHL binders - Nature Communications Citizen science taps the efforts of non-experts. Here, authors describe Drugit, an extension of the crowdsourcing game Foldit, and its use in designing a non-peptide binder of Von Hippel Lindau E3 lig...

Can citizen scientists design real drugs? Check out Drugit: www.nature.com/articles/s41...

Even in the era of AlphaFold, can't help but get super excited at a beautiful xtal 💠! Thanks Adaptyv Bio.

I told AI to make me a protein. Here’s what it came up with A new crop of artificial-intelligence models allows users to create, manipulate and learn about biology using ordinary language.

In our interview with Nature, we explore how AI is learning to design real, functional proteins at 310ai:
www.nature.com/articles/d41...

MP4 uses AI to generate never before seen proteins from text that are validated in the lab. Learn more at the GEM workshop Apr 27 in Singapore at #ICLR2025.

www.biorxiv.org/content/10.1...

After obtaining the results of your research on Copilot, click the share button and export the 3D visualization of the hashtag#protein as an animated GIF.

#AF2BIND is a lightweight and efficient notebook designed for rapid inference on #AlphaFold2 outputs. After loading your protein into Copilot, click #FindPockets in the action box, and within seconds, the binding pockets will be displayed.

AI suggestions anticipate your next moves.

Two clicks to a newly designed protein (using MP3).

On 310 Copilot, you can open the Actions box and, by clicking the #FoldSeek button, quickly perform accurate and sensitive comparisons of large protein structure sets, supporting monomer and multimer searches.

Instantly visualize and design with just a click on the sequence.

It's pretty hard to beat AI cat video cuteness, but here goes 😆

If you're in the LA area, check out Tim's talk at Terasaki!

Nobel Minds 2024 YouTube video by Nobel Prize

David Baker on "traveling light" 🤣
www.youtube.com/watch?v=1tEL...

President Biden Honors Nearly 400 Federally Funded Early-Career Scientists | OSTP | The White House Today, President Biden awarded nearly 400 scientists and engineers the Presidential Early Career Award for Scientists and Engineers (PECASE), the highest honor bestowed by the U.S. government on outst...

400 Presidential Early Career Award for Scientists and Engineers (PECASE) winners!

🏆 www.whitehouse.gov/ostp/news-up...

My brain by ChatGPT😜

2025: Year of Multi

Multi-modal: Protein AI that rolls with your mess—sequences, structures, affinities, whatever.

Multi-functional: Swiss Army AI—ask for anything, gets smarter every time.

Multi-specific: Chaotic toddler tamed. General when needed, sharp where it counts.

Happy 2025! For everyone thinking about New Years goals, some smart person says to be a biologist 😎 .

www.instagram.com/reel/DEB-_4M...

Happy Holidays from the RosettaCommons. Read more: rosettacommons.org/2024/12/19/o...

“Sculpting conducting nanopore size and shape through de novo protein design”

www.biorxiv.org/content/10.1...
github.com/vorobieva/de...

Here goes the skeetorial for the latest preprint from our lab describing RFpeptides, a pipeline for design of target-binding macrocycles using diffusion models. Big shoutout to Stephen Rettie, David Juergens, Victor Adebomi for leading the project (1/n)
Preprint link: www.biorxiv.org/content/10.1...

A synthetic protein-level neural network in mammalian cells Artificial neural networks provide a powerful paradigm for nonbiological information processing. To understand whether similar principles could enable computation within living cells, we combined de n...

Excited to finally share Perceptein, a PERCEPtron made of proTEINs: www.science.org/doi/10.1126/...

Hans Ellegren Welcoming David Baker at Stockholm Arlanda.

Today, several #NobelPrize Laureates arrive in Stockholm, warmly welcomed by Hans Ellegren. Here we see David Baker stepping off the plane at Arlanda.

This week is packed with inspiration, press conferences and lectures, so stay tuned! 🌟
@uofwa.bsky.social @hhmi.bsky.social
#Science #AcademicSky

Our Big Fantastic Virus Database (BFVD) is now published NAR! It contains protein structure predictions of major viral clades, enhanced by petabase-scale homology search and it's explorable on the web.
🌐 bfvd.foldseek.com
💾 bfvd.steineggerlab.workers.dev
📄 academic.oup.com/nar/advance-...

Rosetta Community watching David get the award! @rosettacommons.bsky.social

Nobel Ceremony Highlights:

1) 🥂 To the organizers who pulled off a ridiculously amazing set of events for hundreds of people to come celebrate from all over the world - OMG thank you!!!🏅

2) Will now forever associate the Nobel Prize with Dancing Queen by ABBA

Dinner with David Highlights:

Arthur Kornberg 1959 > PhD student Randy Schekman 2013 > PhD student David Baker 2024 > PhD student ?? in ????

Someone in this picture has a pretty high chance 🤩

Vasa Museum Highlights:
Trying to get David on the Vasa!

Nobel Museum Highlights:
1) Hahnbeom and Sergey win the posing contest
2) We find the famous stick

Nobel Lecture Highlights:
1) David takes a picture of us taking pictures of him.
2) Phil (and I 😅) lose our phones in the lecture hall desks.
3) The Baker entourage hangs out in the lecture hall until security kicks us out.