#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #kimchibulgogimushroomtacoswithgochujangcrema #kimchi #bulgogi #mushroom #tacos #with #gochujang #crema #flour
#Halloumi (in Griechenland Χαλλούμι Challoúmi aka "Quietschekäse") einmal als "Hauptdarsteller"
Serviert auf knusprigen #Erdäpfeln (#Kartoffeln) mit #Rosmarin
Dazu noch grüner Salat mit #Kimchi verfeinert und harten Eiern (von Ostern)
mikekocht.at/2026/04/08/h...
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #gochujangglazedscallopskewerswithcrispykimchiquinoa #gochujang #glazed #scallop #skewers #with #crispy #kimchi #quinoa #cooked
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #creamygochujangsalmon&crispykimchiricebowls #creamy #gochujang #salmon #crispy #kimchi #rice #bowls #cooked
just ate some #kimchi
When asking for something, attach –주세요 to a noun.
[Noun] + 주세요 = Please give me [Noun].
Example:
물 주세요. → Please give me water.
Learn more at - www.skool.com/kultura-keys...
#korea #tourkorea #koreanlangauge #kpop #kdrama #Kimchi #korean #learnkorean #koreanculture #Kculture #koreanvocabulary
It's a #kimchi ham grilled cheese!
Been hearing about all the benefits of kimchi these days? Greater #guthealth, lowers inflammation, boosts immunity
Thanks #Koreans!
My sandwich: grilled chz (white cheddar) w/ ham, runny egg, kimchi, #sourdough bread
How do you like to add kimchi?
Kimchi & Corn Grits
An accidental discovery in trying to fix this bland genre of food: Southern Food. It’s delicious
#corngrits #southernfood #ifixit #kimchi
Scientists in South Korea have identified a surprising ally in the fight against #plasticPollution inside the human body: a microbe commonly found in kimchi.
#nanoplastics #microplastics #kimchi #health
Kimchi – Sliced Napa Cabbage 🌶️
Spicy, tangy, and full of bold flavour. ✨
A perfect kick for any meal.
Now at Bazachi. 🚚
#Bazachi #Kimchi #KoreanFood #SpicyFlavour #FermentedFood #FoodLovers
It's Kimchi, the secret ingredient is Kimchi.
South Korea with another win there!
scitechdaily.com/scientists-say-this-popu...
#Microplastics #Science #Kimchi
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large
Seoul, South Korea: hand-making dumplings at Mangwon market. I tried a mixed plate of three pork-stuffed and two kimchi-stiffed dumplings, jangajji (crispy pickled vegetables) and broth, all delicious and less than US$4 #seoul #dumplings #korea #food #market #kimchi #jangajji #mangwon #koreanfood
I took a chance on a new brand of #kimchi… it’s not as good. will I keep taking wild risks? Absolutely.
Fermentados Naturais e o Seu Impacto na Saúde Intestinal
#chucrute #fermentados #kefir #kimchi #kombucha #microbiota #probióticos #saúdeintestinal #Alimentação #chucrute #fermentados #kefir #kimchi #kombucha #microbiota #probióticos #saúdeintestinal
https://tinyurl.com/23c8pv3y
Busan, South Korea: went for a "hot stone" dinner last night, which was delicious! Everything is cooked at the table on a heated piece of "dolsot", typically made from soapstone or granite composite: rare beef, kimchi, Korean pickles #southkorea #hotstone #beef #kimchi #korea #travel #food #busan
A mason jar with a batch of kimchi in it. Behind the jar is a flower, the flower is not part of the kimchi making. 😉
Trying to make kimchi with vegan alternative(s) for fish sauce. This one has a kelp based tamari to try to get some of that oceany flavor into it. Will see in a week or so if it’s successful or not.
I’m guessing the kimchi will still be good, but whether it […]
[Original post on mastodon.world]
Medical News Today · Maria Cohut, Ph.D.
On Friday, March 27, 2026, the British Heart Foundation (BHF) issued a warning about the potential hidden dangers to cardiovascular health posed by …
#food #kimchi #hearthealth
eating some #kimchi
I LOVE making kimchi stirfried rice with perfecly fried eggos, soft runny yolk and firm eggwhites aaah yummy
[ #food #comfortfood #friedegg #egg #rice #kimchi]
Kimchi Fried Rice: #FriedRice gets a #kimchi makeover that gives you beautiful rice that's full of flavor in mere minutes. Use Korean chili powder, soy sauce, toasted sesame oil, and kimchi from your local Asian market and leftover cooked rice for a quick meal. seasoned.com/blog/2026/03...
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #koreangochujang'porkbelly'mushroomskewers #korean #gochujang #'pork #belly' #mushroom #skewers #king #sesame #kimchi
Zwei Gläser mit Kimchi. Eins von Aldi (Kimchi Pikant) und eins von DM (Bio Kimchi)
#Aldi #Kimchi hat sowas von gewonnen gegen #DM. Einziges Problem: kein Standardsortiment bei Aldi. Das DM Kimchi ist Sauerkraut in scharf. Sehr bissfest dünne Streifen. Und mega sauer 🍋 Eben Sauerkraut. Aldi: Säure ist ausgewogen, die Kohlstücke weich von der Fermentierung. #Vergleich #food
Kombucha was a peasant drink from ancient Manchuria. Now it’s the publicist for the wellness industry.
open.substack.com/pub/thisisga...
#Fermentation #Kombucha #Miso #Kefir #Kimchi #Iru #Injera #Chicha #Idli #Korean #Japanese #Foodsky #Food #Gastromancy #Gastronomy
