40 Savory Tarts and Pies, From Easy Appetizers to Showstopping Centerpieces Go ahead, have pie for dinner. Go ahead, have pie for dinner. Credit: Food & Wine/ Photo by Victor Protasio / Food St...

#Food #Savory #Tart #& #Pastry #Appetizers #Cocktail #Party […]

[Original post on foodandwine.com]

I feel like Ben and Jerry's is trying too hard after they were bought. I mean, an In-N-Out tie-in flavor?? #icecream #savory #uh-nothanks #yuck

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #snack #snackideas #healthysnack #snacktime #sweet&savorytahinigranolaclusters #sweet #savory #tahini #granola #clusters #rolled #mixed #maple

A parody of a taco bell advertisement featuring a giant illustrated soft shell taco with lettuce, tomato, onion, sour cream, taco sauce, and beef. "TACO" is written in all caps with the price of $19.99 below it.

"Taco Taco Taco"

#crispylettuce #savory #juicytomatoes #texmex #cheddar #tacosauce #tortilla #sourcream #tacobell #expensivefood #overpriced #tacotuesday #crispyonions #advertising #restaurants

The Best Savory Finds 🥨.

#SnackTime #Foodie #LocalBusiness #Savory #FoodReels #SmallBusinessSupport