Advertisement · 728 × 90
#
Hashtag
#pancakes
Advertisement · 728 × 90

i love ihop #pancakes

4 0 1 0
Post image Post image Post image Post image

Pancakes 2, Pancake Harder #comic #art #illustration #fox #pancakes #webcomic #outdoors #kid

5 0 0 0
Post image

#easter #pancakes

1 0 0 0
Post image

Sunday breakfast. Chocolate chip pancakes and bubbles!
I love Sunday breakfast. #WineisLove #bubbles #pancakes

Isabelle brut

2 0 1 0
Post image

Pickle & Rye - East Sheen @pickleandrye #pickleandrye #eastsheen #food #london #pancakes

1 0 0 0
Post image

Had to have a dessert
#pancakes
#crepes
#Paris
#Bretonclassic

5 0 0 0
Post image Post image

#Crepes #Pancakes #151ruederocquette
#Paris
No kickbacks just nice food

3 0 0 0
Picture of Nolan Rose cooking pancakes at the Eleanor Easter Breakfast.

Picture of Nolan Rose cooking pancakes at the Eleanor Easter Breakfast.

Making some pancakes 🥞 for the Easter breakfast #eleanorwv #easterbreakfast #pancakes

0 0 0 0
Post image Post image Post image Post image

Pancake Animals: Blueberry Dalmatian in double knit form! 🐶 🫐

This is currently being made with chenille yarn, so stay tuned. After my Easter break, a crochet pattern of the three animals will be released.

#crochet #amigurumi #pancakes #dog

5 0 0 0
Post image

Damn... as April started, I caught a stupid cold.... now this... At least I can treat myself to these delicious breakfasts.
🤧😋🥞🥛 #Pancakes #Breakfast #Cold

I found a new recipe for Pancakes.

0 0 0 0

Guilt free pancakes. We'll, almost. Pancake mix or flour and stuff if yah wanna go scratch. A cup of vanilla Greek yogurt 13 grams protein. Two eggs and milk. Go easy on the butter and pure maple syrup (Sure Jan!) And it's actually good for you. I'll keep repeating that as I eat them.
#pancakes

0 0 0 0
Video

Go ahead and do your best impression of what this means in the comments. #versuswolves #supereyepatchwolf #woolievs #japan #language #linguistics #pancakes #mickeymouse

32 4 3 0
Post image

Casa Lima, San Jose, Costa Rica #pancakes

1 0 0 1
Post image

Ok, Ik I said I wouldn't post again, but then I read Eni's account.... Sorry-
plushie kate's account @enigmaverse.bsky.social
So....lazy, but here is Eni pancakes.
tags:
#comic #Enigmaverse #fanart #Silly #Pancakes #Eni #Kate #lazy

0 1 1 0
Post image

Dit is echt een guilty pleasure #pancakes 🍽️

0 0 0 0
Post image

These wavering feelings,
they’re all still part of love, I think.
#EggsBenedict #CoffeeTime #Pancakes
#HalfAndHalf #BrunchDate #CafeMood

10 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable

0 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large

1 0 0 0
Post image

#caption #contest #captionthis #captions wanted #captionsplease #captionsforinsta #captionsplus #storyprompt #storyprompts #wrongway #wrongturn #wrongnumber #wrongplace #wrongplacewrongtime #wronganswer #wronganswers #wronganswersonly #breakfast #pancakes

0 0 0 0
A big staple of thin pancakes, next to them cut up strawberries, quark, lemon curd, bananas and other things in bowls, glasses, and other containers.

A big staple of thin pancakes, next to them cut up strawberries, quark, lemon curd, bananas and other things in bowls, glasses, and other containers.

We had friends over yesterday (remember the grand piano to be turned into a shelf? The work is progressing...), so I made one of the most comfort meals possible: pancakes! The East-European unleavened version (blini).

One of my favourite toppings is quark […]

[Original post on mastodon.social]

7 2 0 0
Post image Post image

Pumpkin pancakes with onion eggs and fresh blueberry "jam." Happy Saturday!
#pancakes #blueberries #Saturday

3 0 0 0
Post image

🔴We're LIVE and doing a Breakfast Stream! Come join me as I make ✨PANCAKES AND BACON! 🥞🥓✨

I'll be running this stream solo so if you want to see Mama Lumi make you hungry, come join me!

#Vtuber #CookingStream #Pancakes #Vsky #IndieVtuber #Pngtuber #Bacon

8 1 0 0
A delicious breakfast of layered crepes onna white plate and a cappuccino in a blue mug

A delicious breakfast of layered crepes onna white plate and a cappuccino in a blue mug

A delicious pile of layered crepes with sweet cream filling onna white plate

A delicious pile of layered crepes with sweet cream filling onna white plate

Happy Pancake Saturday!!! It’s now a tradition in our house! Mille feuille Crepes with sweet cream layers and a freshly ground cappuccino… OH YASSS!! 🤤

#SpeirGorm #SpéirGorm #SpéirGhorm #Pancakes #Crepes #Breakfast #Cappuchino #Foodie #FoodSky #FoodieSky #MilleFeuille

11 0 1 0
Post image Post image Post image Post image

Saturday morning vibes...🥞🍓🌱📚 And later on I wanna browse our local bookstore...💫Just bc i feel like it, not like I need any and have enough on my tbr already. 😅 #saturdayvibes #books #pancakes #spring

9 0 0 0
Drawing of a stack of pancakes with some berries, whipped cream and a drizzle of syrup.

Drawing of a stack of pancakes with some berries, whipped cream and a drizzle of syrup.

Done sometime in January 2026 in one stream of about 6 hours. Wooden pencils in my toned paper sketchbook.

#traditionalart #woodenpencils #pancakes

1 0 0 0
Video

Pancake art turns an everyday #breakfast into a playful form of expression. The Joy of #Pancakes shows how simple batter, heat & timing can become detailed designs, characters & scenes, all made directly on the pan

Artist @thejoyofpancakes & @danieljamesdrake

Now, I'm hungry🤤

#art #food #creative

21 5 3 0
Post image

Lucifer from Helltaker! #lucifer #helltaker #pancakes #game #videogame #indie #indiegame #steam #fanart #art #sketch #doodle #drawing

13 3 0 0