Sunday breakfast. Chocolate chip pancakes and bubbles!
I love Sunday breakfast. #WineisLove #bubbles #pancakes
Isabelle brut
Pickle & Rye - East Sheen @pickleandrye #pickleandrye #eastsheen #food #london #pancakes
Had to have a dessert
#pancakes
#crepes
#Paris
#Bretonclassic
Picture of Nolan Rose cooking pancakes at the Eleanor Easter Breakfast.
Making some pancakes 🥞 for the Easter breakfast #eleanorwv #easterbreakfast #pancakes
Pancake Animals: Blueberry Dalmatian in double knit form! 🐶 🫐
This is currently being made with chenille yarn, so stay tuned. After my Easter break, a crochet pattern of the three animals will be released.
#crochet #amigurumi #pancakes #dog
Damn... as April started, I caught a stupid cold.... now this... At least I can treat myself to these delicious breakfasts.
🤧😋🥞🥛 #Pancakes #Breakfast #Cold
I found a new recipe for Pancakes.
Guilt free pancakes. We'll, almost. Pancake mix or flour and stuff if yah wanna go scratch. A cup of vanilla Greek yogurt 13 grams protein. Two eggs and milk. Go easy on the butter and pure maple syrup (Sure Jan!) And it's actually good for you. I'll keep repeating that as I eat them.
#pancakes
Go ahead and do your best impression of what this means in the comments. #versuswolves #supereyepatchwolf #woolievs #japan #language #linguistics #pancakes #mickeymouse
Casa Lima, San Jose, Costa Rica #pancakes
Ok, Ik I said I wouldn't post again, but then I read Eni's account.... Sorry-
plushie kate's account @enigmaverse.bsky.social
So....lazy, but here is Eni pancakes.
tags:
#comic #Enigmaverse #fanart #Silly #Pancakes #Eni #Kate #lazy
Dit is echt een guilty pleasure #pancakes 🍽️
These wavering feelings,
they’re all still part of love, I think.
#EggsBenedict #CoffeeTime #Pancakes
#HalfAndHalf #BrunchDate #CafeMood
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large
#caption #contest #captionthis #captions wanted #captionsplease #captionsforinsta #captionsplus #storyprompt #storyprompts #wrongway #wrongturn #wrongnumber #wrongplace #wrongplacewrongtime #wronganswer #wronganswers #wronganswersonly #breakfast #pancakes
A big staple of thin pancakes, next to them cut up strawberries, quark, lemon curd, bananas and other things in bowls, glasses, and other containers.
We had friends over yesterday (remember the grand piano to be turned into a shelf? The work is progressing...), so I made one of the most comfort meals possible: pancakes! The East-European unleavened version (blini).
One of my favourite toppings is quark […]
[Original post on mastodon.social]
Pumpkin pancakes with onion eggs and fresh blueberry "jam." Happy Saturday!
#pancakes #blueberries #Saturday
🔴We're LIVE and doing a Breakfast Stream! Come join me as I make ✨PANCAKES AND BACON! 🥞🥓✨
I'll be running this stream solo so if you want to see Mama Lumi make you hungry, come join me!
#Vtuber #CookingStream #Pancakes #Vsky #IndieVtuber #Pngtuber #Bacon
A delicious breakfast of layered crepes onna white plate and a cappuccino in a blue mug
A delicious pile of layered crepes with sweet cream filling onna white plate
Happy Pancake Saturday!!! It’s now a tradition in our house! Mille feuille Crepes with sweet cream layers and a freshly ground cappuccino… OH YASSS!! 🤤
#SpeirGorm #SpéirGorm #SpéirGhorm #Pancakes #Crepes #Breakfast #Cappuchino #Foodie #FoodSky #FoodieSky #MilleFeuille
Saturday morning vibes...🥞🍓🌱📚 And later on I wanna browse our local bookstore...💫Just bc i feel like it, not like I need any and have enough on my tbr already. 😅 #saturdayvibes #books #pancakes #spring
Drawing of a stack of pancakes with some berries, whipped cream and a drizzle of syrup.
Done sometime in January 2026 in one stream of about 6 hours. Wooden pencils in my toned paper sketchbook.
#traditionalart #woodenpencils #pancakes
Pancake art turns an everyday #breakfast into a playful form of expression. The Joy of #Pancakes shows how simple batter, heat & timing can become detailed designs, characters & scenes, all made directly on the pan
Artist @thejoyofpancakes & @danieljamesdrake
Now, I'm hungry🤤
#art #food #creative
Lucifer from Helltaker! #lucifer #helltaker #pancakes #game #videogame #indie #indiegame #steam #fanart #art #sketch #doodle #drawing
I’ve been possessed with turning out transformation. Become a tongue of a dog, a good boi gooey dog, a toe beans of a furry friend or Sweetie Belle from MLP. All good options.
#transformation #furryart #tongue #mouth #pancakes #objecttf #tf #furrytf #tftg #morphing #mlpfim #ponytf #furrytg #pawtf
The Atlantic County 4-H Youth Council is hosting a, from 8:00 AM to 11:00 AM at the Atlantic County 4-H Center (3210 Rt 50, Mays Landing, NJ). The event honors veterans with free breakfast for veterans and active military
#Veterans #Vietnam #4H #Pancakes #MaysLanding