Advertisement · 728 × 90
#
Hashtag
#chili
Advertisement · 728 × 90
Preview
화사, 새 싱글 ‘So Cute’ MV 티저로 컴백 열기 높였다 #화사 #SoCute #GoodGoodbye #멍청이 #마리아 #Chili #ILoveMyBody #피네이션 화사가 새 디지털 싱글 ‘So Cute’로 돌아오기 전, 뮤직비디오 티저를 먼저 선보이며 컴백 분위기를 끌어올리고 있다. 신곡 발매를 앞두고 영상과 음원 일부가 함께 공개되면서 리스너들의 관심이 모이고 있다. 소속사 피네이션 측에 따르면 화사는 6일 오후 공식 SNS 채널을 통해 디지털 싱글 ‘So Cute(쏘 큐트)’ 뮤직비디오 티저 영상을 업로드했다. 이 영상은 유튜브 등 온라인 채널을 통해 확인할 수 있는 만큼, 팬들은 본편 공개에 앞서 신곡의 일부를 먼저 접하게 됐다. 화사, 리드미컬한 비트와 보컬 담은 ‘So Cute’ MV 티저로 신곡 분위기 선공개. (사진=피네이션) 티저에는 아이들과 함께 시간을 보내는 화사의 모습이 담겼다. 화면은 전체적으로 빈티지한 시네마틱 분위기로 구성돼 있고, 이에 맞춰 따뜻한 장면들이 이어지며 시선을 끈다. 화사의 표정과 동선이 이 미장센 안에 녹아들면서 신곡이 어떤 정서를 품고 있는지 자연스레 드러난다. 음악 역시 티저에서 일부 베일을 걷었다. 리드미컬한 비트 위로 화사 특유의 보컬이 얹히며 귀를 사로잡는 구간이 삽입돼 있어, 본 음원 전체에 대한 궁금증을 남긴다. 짧은 분량이지만 사운드와 목소리의 조합이 강조되면서 곡의 분위기를 미리 체감하게 한다. 이번 티저 공개와 더불어 컴백 카운트다운 콘텐츠도 병행됐다. 7일 0시에는 피네이션 인스타그램 스토리를 통해 ‘컴백 D-2’ 포스터가 등장했다. 도트 원피스에 보터햇을 매치한 화사가 햇살을 받으며 서 있는 장면이 담겨, 우아한 스타일링과 함께 비주얼 콘셉트를 짐작하게 했다. ‘So Cute’는 감각적이고 세련된 멜로디를 내세운 댄스, 팝 장르 곡으로 소개됐다. 경쾌한 흐름을 중심에 두고 있어, 티저에서 드러난 리듬감 있는 사운드와도 맞물린다. 영상과 사운드가 동시에 공개된 만큼, 곡의 전체적인 방향은 뚜렷하게 예고된 상태다. 이번 신곡은 화사의 이전 솔로곡과의 대비도 포인트다. 화사는 전작 ‘Good Goodbye(굿 굿바이)’에서 보여준 스타일과는 다른 매력이 묻어나는 경쾌한 멜로디와 퍼포먼스를 통해 또 다른 모습을 선보일 계획이다. 이를 통해 무대 위에서 어떤 변주를 보여줄지에 대한 기대도 함께 커지고 있다. 그동안 화사는 ‘멍청이(twit)’, ‘마리아(Maria)’, ‘Chili(칠리)’, ‘I Love My Body(아이 러브 마이 바디)’ 등 솔로 작업을 통해 자신만의 색깔을 확실히 쌓아왔다. 각 곡에서 개성 있는 음악과 퍼포먼스를 선보이며 리스너들의 호응을 얻었고, 이를 기반으로 솔로 활동 영역을 넓혀왔다. 특히 ‘Good Goodbye’로는 솔로 데뷔 후 최고 성적을 기록한 바 있다. 이 성과를 발판 삼아 화사는 ‘K팝 대표 솔로 퀸’이라는 수식을 굳히며 활동을 이어가고 있다. 매 컴백마다 지표를 새로 쓰는 흐름을 보여주고 있는 만큼, ‘So Cute’가 추가로 어떤 결과를 만들지 이목이 쏠린다. 이번 ‘So Cute’ 뮤직비디오 티저와 컴백 D-2 포스터는 새 싱글의 영상 콘셉트와 음악 방향을 함께 제시하는 역할을 하고 있다. 화사의 새 디지털 싱글 ‘So Cute’는 9일 오후 6시 각종 온라인 음원 사이트를 통해 발매된다.

화사, 새 싱글 ‘So Cute’ MV 티저로 컴백 열기 높였다 #화사 #SoCute #GoodGoodbye #멍청이 #마리아 #Chili #ILoveMyBody #피네이션

0 0 0 0
Post image Post image

Spätes Chili, gutes Chili
Mit etwas Koriander oben drauf.
Etwas Quark druntergehoben
#chili

3 0 0 0
A table filled with 18 small pots containing chili plant seedlings in various sizes. From very tiny stems with two small leaves to 20cm high with large green leaves.

A table filled with 18 small pots containing chili plant seedlings in various sizes. From very tiny stems with two small leaves to 20cm high with large green leaves.

Personal health reasons led to a bit of a chaotic start for my #chili #pepper #Plants this year. Only about half of the plants I had last year and a very uneven start. But still: better than nothing.
New this year are Scotch Bonnet and Orange Habanero.

0 1 0 0
Post image Post image

APRIL 5, 1982
ARTIST: Abel Quezada
ADVERTISEMENT: Baker Knapp & Tubbs
|
|
|
|
|
|
#newyorkercovers #newyorker #newyorkermag #illustration #1982 #abelquezada #rita #chili #tranquil #manhattan #streetlife #vintageads #baker #knapp #tubbs #furniture

5 1 0 0
Post image Post image

#Chili from TLC
this is her man?
For real?
#Scrub yo, scrub!
This some crazy ish

0 0 0 0
Collage aus vier Chilisorten mit dunklen Blättern: Fidalgo Roxa, Royal Black, Dark Rios de Lava und Count Dracula.

Collage aus vier Chilisorten mit dunklen Blättern: Fidalgo Roxa, Royal Black, Dark Rios de Lava und Count Dracula.

Einer der Schwerpunkte dieses Jahr: Chilis mit dunklem Laub.
#Chili #chilipeppers #chilihomegrown

11 0 0 0
Collage aus vier Chilisorten mit dunklen Blättern: Fidalgo Roxa, Royal Black, Dark Rios de Lava und Count Dracula.

Collage aus vier Chilisorten mit dunklen Blättern: Fidalgo Roxa, Royal Black, Dark Rios de Lava und Count Dracula.

Einer der Schwerpunkte dieses Jahr: Chilis mit dunklem Laub.
#Chili #chilipeppers #chilihomegrown

1 0 0 0
Post image

Heute auf unserem Mittagstisch: Seelachs mit Erbsen in einer zitronigen Kokos-Chili-Sauce

#mittagstisch #chili

4 0 0 0
Post image

Today’s #rotd is #grilled #sweet #chili #halloumi #cheese over #coconut #lime #rice!

#cooking #mentalhealth #struggle #kitchen #tasty #delicious #food #easy #simple #recipe

3 1 0 0
Chili from TLC paid into trump administration 👀 #chili #tlc #trump #republicans
Chili from TLC paid into trump administration 👀 #chili #tlc #trump #republicans YouTube video by Darkskin_qqueen2.0

Chili from TLC paid into trump administration 👀 #chili #tlc #trump #republicans
youtube.com/shorts/q1WfR...

0 0 0 0
Chili : le gouvernement de Kast annonce suspendre un plan de régularisation de migrants - [Marie-Claude Saliceti]

RFI
Chili : le gouvernement de Kast annonce suspendre un plan de régularisation de migrants
mcinformactions.net/chili-le-gouvernement-de...
#Chili #extremedroite #migrants #immigration #expulsions

0 1 0 0
Do Chili or Nick Cannon deserve a pass?
Do Chili or Nick Cannon deserve a pass? YouTube video by Dr. Omekongo Dibinga

Do Chili or Nick Cannon deserve a pass? youtu.be/Bkep5qQPMS4?... #chili #nickcannon #trump #maga #upstander #envogue #saltnpepa

2 1 1 0
Post image

Darwin : la révolution qui a tout bousculé www.vers2045.com/19/03/2026/d...
#Brésil #Pérou #Chili #Argentine #Equateur #Colombie #Venezuela #Paraguay #Honduras #Uruguay #Bolivie #Guyana #Mexique

0 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable

0 0 0 0
Preview
#BreakingNewsFromBranden - #Chili from #TLC has been exposed as a Trump supporter. #Blackwomen #blackrepublican TikTok video by Branden Lee

#Chili from #TLC is getting dragged after being exposed as a Trump supporter. #BreakingNewsWithBranden

www.tiktok.com/t/ZP8bWkJtf/

0 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large

1 0 0 0
Post image

At only about 200 calories, this bowl packs a satisfying, super healthy punch. Quinoa Vegetarian Chili. A tasty, nutritious Meatless Monday Meal! RECIPE HERE: www.rockrecipes.com/quinoa-veget...

#quinoa #quinoarecipes #chili #healthyeating #healthyfood #healthylifestyle #weightloss #healthy

1 1 0 0
Why are Black Celebrities Turning Pro-Trump/ MAGA?
Why are Black Celebrities Turning Pro-Trump/ MAGA? YouTube video by DrJasonJohnson

#NickCannon #Chili youtu.be/_H0fQhjGs8g?...

4 0 0 0

#TLC #Chili (Rozonda Thomas) has a decades long history of making really bad choices… This includes her current “MAGA BOO THANG”; Matthew Lawrence who hasn’t starred in a decent film or television show, in years…

0 0 0 0
Preview
Post from TabithaSpeaksPolitics - YouTube Lord, they are still digging up receipts on Chilli…

#Chili is a big lying MAGA Trump fan!

Look at ALL 3 REPOSTS...

@joyannreid.bsky.social @donlemonofficial.bsky.social @rolandsmartin.bsky.social

youtube.com/post/Ugkxs0B...

0 0 0 0
Preview
Post from TabithaSpeaksPolitics - YouTube Lord, they are still digging up receipts on Chilli…

#CHILI still getting dragged as MORE RECIEPTS are found ...

@accesshollywood.bsky.social @joyannreid.bsky.social

An apology public to Mrs Obama would have been better than bring caught in all these damned lies!

youtube.com/post/Ugkxs0B...

0 0 0 0
A purple labeled pint can shows a horned red eyed frog sticking out its red tongue with bold white lettering. A snifter glass full of dark ruby ale is to the right, bathed in bright sunlight

A purple labeled pint can shows a horned red eyed frog sticking out its red tongue with bold white lettering. A snifter glass full of dark ruby ale is to the right, bathed in bright sunlight

66F sunny, just a beautiful day. So who brought me this cold bug? Let’s burn that gunk out of my head.

#hoppinFrog BA Bite of the Beast #barleywine

Chili punch, full bodied caramel & vanilla with a hot bourbon finish. 18.8%!!

Wait, my nose is running…

#itsWorking #craftbeer #chili #bSkyBeer

10 0 1 0
Video

#chili

0 0 0 0
Post image

Slow progress. But progress. #chili

6 1 0 0

NOT SHOCKED!
🤦🏽‍♀️🎶🤦🏽‍♀️🎶🤦🏽‍♀️🎶🤦🏽‍♀️
#Chili of #TLC fame has a decades long pattern of making really bad decisions…

2 0 0 0
Post image Post image

52 Weeks of Cooking: Week 13 - Chilis

Chilis in our chili

#52weeksofcooking #reddit #cooking #challenge #chilis #chili #homemade #food

0 0 0 0
Post image

#FoodSky
#What'sCooking
#Chili
#Vegetables
#Vegan
#Homemade

🍽️🍜
Seemed like a vegetable chili day...and voilà. Extra-sharp cheddar, lots of spice, a bit of lime. 👍🍲❤️

6 0 0 0
Post image

Hatch chile red wine in New Mexico, USA. Well, you know, when in Rome! I wasn't sure how it would taste, but it was delightful! And very, as they say in the UK, "moreish". I bought several more bottles that week #hatch #chili #chile #redwine #newmexico #food #wine #travel #chilipepper #spicy

5 0 0 0
Post image

🥤🐦‍⬛Groups lost their Joy. Gotta go find it.
.
#Ed #Betty #Chili #comic #oc #dialow #insanedingo

39 6 1 0
Original post on societyofrock.com

Why Anthony Kiedis Vanished After Hillel Slovak Died In the Netflix documentary The Rise of the Red Hot Chili Peppers: Our Brother, Hillel, Anthony Kiedis revisits one of the most painful chapters ...

#March #2026 #Anthony #Kiedis #Hillel #Slovak #Red #Hot […]

[Original post on societyofrock.com]

0 0 0 0