Collage aus vier Chilisorten mit dunklen Blättern: Fidalgo Roxa, Royal Black, Dark Rios de Lava und Count Dracula.
Einer der Schwerpunkte dieses Jahr: Chilis mit dunklem Laub.
#Chili #chilipeppers #chilihomegrown
Collage aus vier Chilisorten mit dunklen Blättern: Fidalgo Roxa, Royal Black, Dark Rios de Lava und Count Dracula.
Einer der Schwerpunkte dieses Jahr: Chilis mit dunklem Laub.
#Chili #chilipeppers #chilihomegrown
Heute auf unserem Mittagstisch: Seelachs mit Erbsen in einer zitronigen Kokos-Chili-Sauce
#mittagstisch #chili
Today’s #rotd is #grilled #sweet #chili #halloumi #cheese over #coconut #lime #rice!
#cooking #mentalhealth #struggle #kitchen #tasty #delicious #food #easy #simple #recipe
Chili from TLC paid into trump administration 👀 #chili #tlc #trump #republicans
youtube.com/shorts/q1WfR...
RFI
Chili : le gouvernement de Kast annonce suspendre un plan de régularisation de migrants
mcinformactions.net/chili-le-gouvernement-de...
#Chili #extremedroite #migrants #immigration #expulsions
Do Chili or Nick Cannon deserve a pass? youtu.be/Bkep5qQPMS4?... #chili #nickcannon #trump #maga #upstander #envogue #saltnpepa
Darwin : la révolution qui a tout bousculé www.vers2045.com/19/03/2026/d...
#Brésil #Pérou #Chili #Argentine #Equateur #Colombie #Venezuela #Paraguay #Honduras #Uruguay #Bolivie #Guyana #Mexique
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable
#Chili from #TLC is getting dragged after being exposed as a Trump supporter. #BreakingNewsWithBranden
www.tiktok.com/t/ZP8bWkJtf/
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large
At only about 200 calories, this bowl packs a satisfying, super healthy punch. Quinoa Vegetarian Chili. A tasty, nutritious Meatless Monday Meal! RECIPE HERE: www.rockrecipes.com/quinoa-veget...
#quinoa #quinoarecipes #chili #healthyeating #healthyfood #healthylifestyle #weightloss #healthy
#NickCannon #Chili youtu.be/_H0fQhjGs8g?...
#TLC #Chili (Rozonda Thomas) has a decades long history of making really bad choices… This includes her current “MAGA BOO THANG”; Matthew Lawrence who hasn’t starred in a decent film or television show, in years…
#Chili is a big lying MAGA Trump fan!
Look at ALL 3 REPOSTS...
@joyannreid.bsky.social @donlemonofficial.bsky.social @rolandsmartin.bsky.social
youtube.com/post/Ugkxs0B...
#CHILI still getting dragged as MORE RECIEPTS are found ...
@accesshollywood.bsky.social @joyannreid.bsky.social
An apology public to Mrs Obama would have been better than bring caught in all these damned lies!
youtube.com/post/Ugkxs0B...
A purple labeled pint can shows a horned red eyed frog sticking out its red tongue with bold white lettering. A snifter glass full of dark ruby ale is to the right, bathed in bright sunlight
66F sunny, just a beautiful day. So who brought me this cold bug? Let’s burn that gunk out of my head.
#hoppinFrog BA Bite of the Beast #barleywine
Chili punch, full bodied caramel & vanilla with a hot bourbon finish. 18.8%!!
Wait, my nose is running…
#itsWorking #craftbeer #chili #bSkyBeer
Slow progress. But progress. #chili
NOT SHOCKED!
🤦🏽♀️🎶🤦🏽♀️🎶🤦🏽♀️🎶🤦🏽♀️
#Chili of #TLC fame has a decades long pattern of making really bad decisions…
52 Weeks of Cooking: Week 13 - Chilis
Chilis in our chili
#52weeksofcooking #reddit #cooking #challenge #chilis #chili #homemade #food
#FoodSky
#What'sCooking
#Chili
#Vegetables
#Vegan
#Homemade
🍽️🍜
Seemed like a vegetable chili day...and voilà. Extra-sharp cheddar, lots of spice, a bit of lime. 👍🍲❤️
Hatch chile red wine in New Mexico, USA. Well, you know, when in Rome! I wasn't sure how it would taste, but it was delightful! And very, as they say in the UK, "moreish". I bought several more bottles that week #hatch #chili #chile #redwine #newmexico #food #wine #travel #chilipepper #spicy
Why Anthony Kiedis Vanished After Hillel Slovak Died In the Netflix documentary The Rise of the Red Hot Chili Peppers: Our Brother, Hillel, Anthony Kiedis revisits one of the most painful chapters ...
#March #2026 #Anthony #Kiedis #Hillel #Slovak #Red #Hot […]
[Original post on societyofrock.com]
Dags att så c flexuosum. En chilisort som är frosthärdig. Jag har tre plantor i växthuset så nu skall det bli fler genetiskt skilda plantor.
Den kan inte pollinera sig själv så det krävs olika plantor för att det skall bli frukt
#chili #odla #flexuosum #lilltorp #gårdsliv
I did a hot dog again but a little differently. I was inspired by the new spring season. Ziti is attacking the bags again. #Hotdogs #baseball #chili #cooking #CookingSky #TheOutpost
ko-fi.com/Post/The-Bal...