Advertisement · 728 × 90
#
Hashtag
#Chili
Advertisement · 728 × 90
Post image Post image

#Chili from TLC
this is her man?
For real?
#Scrub yo, scrub!
This some crazy ish

0 0 0 0
Collage aus vier Chilisorten mit dunklen Blättern: Fidalgo Roxa, Royal Black, Dark Rios de Lava und Count Dracula.

Collage aus vier Chilisorten mit dunklen Blättern: Fidalgo Roxa, Royal Black, Dark Rios de Lava und Count Dracula.

Einer der Schwerpunkte dieses Jahr: Chilis mit dunklem Laub.
#Chili #chilipeppers #chilihomegrown

10 0 0 0
Collage aus vier Chilisorten mit dunklen Blättern: Fidalgo Roxa, Royal Black, Dark Rios de Lava und Count Dracula.

Collage aus vier Chilisorten mit dunklen Blättern: Fidalgo Roxa, Royal Black, Dark Rios de Lava und Count Dracula.

Einer der Schwerpunkte dieses Jahr: Chilis mit dunklem Laub.
#Chili #chilipeppers #chilihomegrown

1 0 0 0
Post image

Heute auf unserem Mittagstisch: Seelachs mit Erbsen in einer zitronigen Kokos-Chili-Sauce

#mittagstisch #chili

4 0 0 0
Post image

Today’s #rotd is #grilled #sweet #chili #halloumi #cheese over #coconut #lime #rice!

#cooking #mentalhealth #struggle #kitchen #tasty #delicious #food #easy #simple #recipe

3 1 0 0
Chili from TLC paid into trump administration 👀 #chili #tlc #trump #republicans
Chili from TLC paid into trump administration 👀 #chili #tlc #trump #republicans YouTube video by Darkskin_qqueen2.0

Chili from TLC paid into trump administration 👀 #chili #tlc #trump #republicans
youtube.com/shorts/q1WfR...

0 0 0 0
Chili : le gouvernement de Kast annonce suspendre un plan de régularisation de migrants - [Marie-Claude Saliceti]

RFI
Chili : le gouvernement de Kast annonce suspendre un plan de régularisation de migrants
mcinformactions.net/chili-le-gouvernement-de...
#Chili #extremedroite #migrants #immigration #expulsions

0 1 0 0
Do Chili or Nick Cannon deserve a pass?
Do Chili or Nick Cannon deserve a pass? YouTube video by Dr. Omekongo Dibinga

Do Chili or Nick Cannon deserve a pass? youtu.be/Bkep5qQPMS4?... #chili #nickcannon #trump #maga #upstander #envogue #saltnpepa

2 1 1 0
Post image

Darwin : la révolution qui a tout bousculé www.vers2045.com/19/03/2026/d...
#Brésil #Pérou #Chili #Argentine #Equateur #Colombie #Venezuela #Paraguay #Honduras #Uruguay #Bolivie #Guyana #Mexique

0 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable

0 0 0 0
Preview
#BreakingNewsFromBranden - #Chili from #TLC has been exposed as a Trump supporter. #Blackwomen #blackrepublican TikTok video by Branden Lee

#Chili from #TLC is getting dragged after being exposed as a Trump supporter. #BreakingNewsWithBranden

www.tiktok.com/t/ZP8bWkJtf/

0 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large

1 0 0 0
Post image

At only about 200 calories, this bowl packs a satisfying, super healthy punch. Quinoa Vegetarian Chili. A tasty, nutritious Meatless Monday Meal! RECIPE HERE: www.rockrecipes.com/quinoa-veget...

#quinoa #quinoarecipes #chili #healthyeating #healthyfood #healthylifestyle #weightloss #healthy

1 1 0 0
Why are Black Celebrities Turning Pro-Trump/ MAGA?
Why are Black Celebrities Turning Pro-Trump/ MAGA? YouTube video by DrJasonJohnson

#NickCannon #Chili youtu.be/_H0fQhjGs8g?...

4 0 0 0

#TLC #Chili (Rozonda Thomas) has a decades long history of making really bad choices… This includes her current “MAGA BOO THANG”; Matthew Lawrence who hasn’t starred in a decent film or television show, in years…

0 0 0 0
Preview
Post from TabithaSpeaksPolitics - YouTube Lord, they are still digging up receipts on Chilli…

#Chili is a big lying MAGA Trump fan!

Look at ALL 3 REPOSTS...

@joyannreid.bsky.social @donlemonofficial.bsky.social @rolandsmartin.bsky.social

youtube.com/post/Ugkxs0B...

0 0 0 0
Preview
Post from TabithaSpeaksPolitics - YouTube Lord, they are still digging up receipts on Chilli…

#CHILI still getting dragged as MORE RECIEPTS are found ...

@accesshollywood.bsky.social @joyannreid.bsky.social

An apology public to Mrs Obama would have been better than bring caught in all these damned lies!

youtube.com/post/Ugkxs0B...

0 0 0 0
A purple labeled pint can shows a horned red eyed frog sticking out its red tongue with bold white lettering. A snifter glass full of dark ruby ale is to the right, bathed in bright sunlight

A purple labeled pint can shows a horned red eyed frog sticking out its red tongue with bold white lettering. A snifter glass full of dark ruby ale is to the right, bathed in bright sunlight

66F sunny, just a beautiful day. So who brought me this cold bug? Let’s burn that gunk out of my head.

#hoppinFrog BA Bite of the Beast #barleywine

Chili punch, full bodied caramel & vanilla with a hot bourbon finish. 18.8%!!

Wait, my nose is running…

#itsWorking #craftbeer #chili #bSkyBeer

10 0 1 0
Video

#chili

0 0 0 0
Post image

Slow progress. But progress. #chili

6 1 0 0

NOT SHOCKED!
🤦🏽‍♀️🎶🤦🏽‍♀️🎶🤦🏽‍♀️🎶🤦🏽‍♀️
#Chili of #TLC fame has a decades long pattern of making really bad decisions…

1 0 0 0
Post image Post image

52 Weeks of Cooking: Week 13 - Chilis

Chilis in our chili

#52weeksofcooking #reddit #cooking #challenge #chilis #chili #homemade #food

0 0 0 0
Post image

#FoodSky
#What'sCooking
#Chili
#Vegetables
#Vegan
#Homemade

🍽️🍜
Seemed like a vegetable chili day...and voilà. Extra-sharp cheddar, lots of spice, a bit of lime. 👍🍲❤️

6 0 0 0
Post image

Hatch chile red wine in New Mexico, USA. Well, you know, when in Rome! I wasn't sure how it would taste, but it was delightful! And very, as they say in the UK, "moreish". I bought several more bottles that week #hatch #chili #chile #redwine #newmexico #food #wine #travel #chilipepper #spicy

5 0 0 0
Post image

🥤🐦‍⬛Groups lost their Joy. Gotta go find it.
.
#Ed #Betty #Chili #comic #oc #dialow #insanedingo

38 6 1 0
Original post on societyofrock.com

Why Anthony Kiedis Vanished After Hillel Slovak Died In the Netflix documentary The Rise of the Red Hot Chili Peppers: Our Brother, Hillel, Anthony Kiedis revisits one of the most painful chapters ...

#March #2026 #Anthony #Kiedis #Hillel #Slovak #Red #Hot […]

[Original post on societyofrock.com]

0 0 0 0
Video

Dags att så c flexuosum. En chilisort som är frosthärdig. Jag har tre plantor i växthuset så nu skall det bli fler genetiskt skilda plantor.
Den kan inte pollinera sig själv så det krävs olika plantor för att det skall bli frukt

#chili #odla #flexuosum #lilltorp #gårdsliv

0 0 0 0
Preview
The Ball Park Style Hot Dog. Montis Boeher published a post on Ko-fi

I did a hot dog again but a little differently. I was inspired by the new spring season. Ziti is attacking the bags again. #Hotdogs #baseball #chili #cooking #CookingSky #TheOutpost

ko-fi.com/Post/The-Bal...

22 0 6 0
Post image

"Hey Ernest! How much #cheese do you want in your #chili?"

"Yes."

1 1 0 0
Post image

L’intelligence artificielle : le moteur de la robotique chinoise www.vers2045.com/25/03/2026/l...
#Brésil #Pérou #Chili #Argentine #Equateur #Colombie #Venezuela #Paraguay #Honduras #Uruguay #Bolivie #Guyana #Mexique

0 1 0 0