Scientists in South Korea have identified a surprising ally in the fight against #plasticPollution inside the human body: a microbe commonly found in kimchi.
#nanoplastics #microplastics #kimchi #health
Kimchi – Sliced Napa Cabbage 🌶️
Spicy, tangy, and full of bold flavour. ✨
A perfect kick for any meal.
Now at Bazachi. 🚚
#Bazachi #Kimchi #KoreanFood #SpicyFlavour #FermentedFood #FoodLovers
It's Kimchi, the secret ingredient is Kimchi.
South Korea with another win there!
scitechdaily.com/scientists-say-this-popu...
#Microplastics #Science #Kimchi
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large
Seoul, South Korea: hand-making dumplings at Mangwon market. I tried a mixed plate of three pork-stuffed and two kimchi-stiffed dumplings, jangajji (crispy pickled vegetables) and broth, all delicious and less than US$4 #seoul #dumplings #korea #food #market #kimchi #jangajji #mangwon #koreanfood
I took a chance on a new brand of #kimchi… it’s not as good. will I keep taking wild risks? Absolutely.
Fermentados Naturais e o Seu Impacto na Saúde Intestinal
#chucrute #fermentados #kefir #kimchi #kombucha #microbiota #probióticos #saúdeintestinal #Alimentação #chucrute #fermentados #kefir #kimchi #kombucha #microbiota #probióticos #saúdeintestinal
https://tinyurl.com/23c8pv3y
Busan, South Korea: went for a "hot stone" dinner last night, which was delicious! Everything is cooked at the table on a heated piece of "dolsot", typically made from soapstone or granite composite: rare beef, kimchi, Korean pickles #southkorea #hotstone #beef #kimchi #korea #travel #food #busan
A mason jar with a batch of kimchi in it. Behind the jar is a flower, the flower is not part of the kimchi making. 😉
Trying to make kimchi with vegan alternative(s) for fish sauce. This one has a kelp based tamari to try to get some of that oceany flavor into it. Will see in a week or so if it’s successful or not.
I’m guessing the kimchi will still be good, but whether it […]
[Original post on mastodon.world]
Medical News Today · Maria Cohut, Ph.D.
On Friday, March 27, 2026, the British Heart Foundation (BHF) issued a warning about the potential hidden dangers to cardiovascular health posed by …
#food #kimchi #hearthealth
Naughty!! #Kimchi 🐈
eating some #kimchi
I LOVE making kimchi stirfried rice with perfecly fried eggos, soft runny yolk and firm eggwhites aaah yummy
[ #food #comfortfood #friedegg #egg #rice #kimchi]
Kimchi Fried Rice: #FriedRice gets a #kimchi makeover that gives you beautiful rice that's full of flavor in mere minutes. Use Korean chili powder, soy sauce, toasted sesame oil, and kimchi from your local Asian market and leftover cooked rice for a quick meal. seasoned.com/blog/2026/03...
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #koreangochujang'porkbelly'mushroomskewers #korean #gochujang #'pork #belly' #mushroom #skewers #king #sesame #kimchi
Zwei Gläser mit Kimchi. Eins von Aldi (Kimchi Pikant) und eins von DM (Bio Kimchi)
#Aldi #Kimchi hat sowas von gewonnen gegen #DM. Einziges Problem: kein Standardsortiment bei Aldi. Das DM Kimchi ist Sauerkraut in scharf. Sehr bissfest dünne Streifen. Und mega sauer 🍋 Eben Sauerkraut. Aldi: Säure ist ausgewogen, die Kohlstücke weich von der Fermentierung. #Vergleich #food
Kombucha was a peasant drink from ancient Manchuria. Now it’s the publicist for the wellness industry.
open.substack.com/pub/thisisga...
#Fermentation #Kombucha #Miso #Kefir #Kimchi #Iru #Injera #Chicha #Idli #Korean #Japanese #Foodsky #Food #Gastromancy #Gastronomy
kochuaustin.com
kochuaustin.com
Kochu:
Best in Austin, TX. Korean
#Kimchi
Artstrada Magazine recommended BITES 🫦 WWW.ARTSTRADAMAGAZINE.COM
Fermented Foods Do More Than Help the Gut
Live microbes in foods like yogurt, sauerkraut or kimchi can improve cholesterol, insulin control and belly fat. www.thedoctorwillseeyounow.com/content/gast... #microbes #microbiota #fermentedfood #kimchi #kefir #Yogurt #diabetes #cholesterol #gut
Kimchi – Sliced Napa Cabbage 🌶️
Bold. Tangy. Authentic. ✨
Traditional Korean flavour with the perfect balance of spice and crunch.
Add a kick to your meals — now at Bazachi. 🚚
#Bazachi #Kimchi #KoreanFood #SpicyFlavour #FermentedGoodness #FoodLovers
Come and join us and learn a new skill! We have lots of new dates for fermentation workshops on our website now
thefermentarium.org.uk/courses/cate...
#fermentation #sourdough #kimchi #kefir #kombucha #giftvouchers #walthamstow
I just made my first fermentation crock for kimchi and sauerkraut etc. The body didn't get as much reduction as intended but the lid is nice and toasty. Shino glaze.
I have more coming in the next firing, both this style and the Korean style with no water trap rim.
#ceramics #pottery #kimchi
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #bulgogibeef&kimchipowerbowlswithcrispyseaweed #bulgogi #beef #kimchi #power #bowls #with #crispy #seaweed #purple #aioli
#TarotOfTheDay is #DragRaceTarot #DragRace #TheIcon #KimChi representing the king of 🪄s u R stepping into powerful leadership energy right now. This card shows confidence, vision, the courage to go after what you want. Trust your ideas & take the lead others may naturally look to you for direction🔥
'n goed bestede zondagmiddag. #ferment #kimchi #guthealth