Advertisement · 728 × 90
#
Hashtag
#ChiLi
Advertisement · 728 × 90
Do Chili or Nick Cannon deserve a pass?
Do Chili or Nick Cannon deserve a pass? YouTube video by Dr. Omekongo Dibinga

Do Chili or Nick Cannon deserve a pass? youtu.be/Bkep5qQPMS4?... #chili #nickcannon #trump #maga #upstander #envogue #saltnpepa

0 0 0 0
Post image

Darwin : la révolution qui a tout bousculé www.vers2045.com/19/03/2026/d...
#Brésil #Pérou #Chili #Argentine #Equateur #Colombie #Venezuela #Paraguay #Honduras #Uruguay #Bolivie #Guyana #Mexique

0 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable

0 0 0 0
Preview
#BreakingNewsFromBranden - #Chili from #TLC has been exposed as a Trump supporter. #Blackwomen #blackrepublican TikTok video by Branden Lee

#Chili from #TLC is getting dragged after being exposed as a Trump supporter. #BreakingNewsWithBranden

www.tiktok.com/t/ZP8bWkJtf/

0 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large

1 0 0 0
Post image

At only about 200 calories, this bowl packs a satisfying, super healthy punch. Quinoa Vegetarian Chili. A tasty, nutritious Meatless Monday Meal! RECIPE HERE: www.rockrecipes.com/quinoa-veget...

#quinoa #quinoarecipes #chili #healthyeating #healthyfood #healthylifestyle #weightloss #healthy

1 1 0 0
Why are Black Celebrities Turning Pro-Trump/ MAGA?
Why are Black Celebrities Turning Pro-Trump/ MAGA? YouTube video by DrJasonJohnson

#NickCannon #Chili youtu.be/_H0fQhjGs8g?...

4 0 0 0

#TLC #Chili (Rozonda Thomas) has a decades long history of making really bad choices… This includes her current “MAGA BOO THANG”; Matthew Lawrence who hasn’t starred in a decent film or television show, in years…

0 0 0 0
Preview
Post from TabithaSpeaksPolitics - YouTube Lord, they are still digging up receipts on Chilli…

#Chili is a big lying MAGA Trump fan!

Look at ALL 3 REPOSTS...

@joyannreid.bsky.social @donlemonofficial.bsky.social @rolandsmartin.bsky.social

youtube.com/post/Ugkxs0B...

0 0 0 0
Preview
Post from TabithaSpeaksPolitics - YouTube Lord, they are still digging up receipts on Chilli…

#CHILI still getting dragged as MORE RECIEPTS are found ...

@accesshollywood.bsky.social @joyannreid.bsky.social

An apology public to Mrs Obama would have been better than bring caught in all these damned lies!

youtube.com/post/Ugkxs0B...

0 0 0 0
A purple labeled pint can shows a horned red eyed frog sticking out its red tongue with bold white lettering. A snifter glass full of dark ruby ale is to the right, bathed in bright sunlight

A purple labeled pint can shows a horned red eyed frog sticking out its red tongue with bold white lettering. A snifter glass full of dark ruby ale is to the right, bathed in bright sunlight

66F sunny, just a beautiful day. So who brought me this cold bug? Let’s burn that gunk out of my head.

#hoppinFrog BA Bite of the Beast #barleywine

Chili punch, full bodied caramel & vanilla with a hot bourbon finish. 18.8%!!

Wait, my nose is running…

#itsWorking #craftbeer #chili #bSkyBeer

9 0 1 0
Video

#chili

0 0 0 0
Post image

Slow progress. But progress. #chili

6 1 0 0

NOT SHOCKED!
🤦🏽‍♀️🎶🤦🏽‍♀️🎶🤦🏽‍♀️🎶🤦🏽‍♀️
#Chili of #TLC fame has a decades long pattern of making really bad decisions…

1 0 0 0
Post image Post image

52 Weeks of Cooking: Week 13 - Chilis

Chilis in our chili

#52weeksofcooking #reddit #cooking #challenge #chilis #chili #homemade #food

0 0 0 0
Post image

#FoodSky
#What'sCooking
#Chili
#Vegetables
#Vegan
#Homemade

🍽️🍜
Seemed like a vegetable chili day...and voilà. Extra-sharp cheddar, lots of spice, a bit of lime. 👍🍲❤️

6 0 0 0
Post image

Hatch chile red wine in New Mexico, USA. Well, you know, when in Rome! I wasn't sure how it would taste, but it was delightful! And very, as they say in the UK, "moreish". I bought several more bottles that week #hatch #chili #chile #redwine #newmexico #food #wine #travel #chilipepper #spicy

5 0 0 0
Post image

🥤🐦‍⬛Groups lost their Joy. Gotta go find it.
.
#Ed #Betty #Chili #comic #oc #dialow #insanedingo

37 5 1 0
Original post on societyofrock.com

Why Anthony Kiedis Vanished After Hillel Slovak Died In the Netflix documentary The Rise of the Red Hot Chili Peppers: Our Brother, Hillel, Anthony Kiedis revisits one of the most painful chapters ...

#March #2026 #Anthony #Kiedis #Hillel #Slovak #Red #Hot […]

[Original post on societyofrock.com]

0 0 0 0
Video

Dags att så c flexuosum. En chilisort som är frosthärdig. Jag har tre plantor i växthuset så nu skall det bli fler genetiskt skilda plantor.
Den kan inte pollinera sig själv så det krävs olika plantor för att det skall bli frukt

#chili #odla #flexuosum #lilltorp #gårdsliv

0 0 0 0
Preview
The Ball Park Style Hot Dog. Montis Boeher published a post on Ko-fi

I did a hot dog again but a little differently. I was inspired by the new spring season. Ziti is attacking the bags again. #Hotdogs #baseball #chili #cooking #CookingSky #TheOutpost

ko-fi.com/Post/The-Bal...

22 0 6 0
Post image

"Hey Ernest! How much #cheese do you want in your #chili?"

"Yes."

1 1 0 0
Post image

L’intelligence artificielle : le moteur de la robotique chinoise www.vers2045.com/25/03/2026/l...
#Brésil #Pérou #Chili #Argentine #Equateur #Colombie #Venezuela #Paraguay #Honduras #Uruguay #Bolivie #Guyana #Mexique

0 1 0 0
Post image

Some like it hot!
#potholder #mugrug #cooking #hotpad #baking #chili #coasters #handmade #Chipotle #drinkmat #peppers #hotpeppers #freeshipping @2Fun4Words

etsy.me/3DA8RS4

3 2 0 0
Post image

I just made the greatest bowl of chili ever in the world. This is not up for debate. It is fact. No, you can't have any. You will take my word for it and praise me accordingly.

Thank you for your attention in this matter.

#foodsky #chili

1 0 0 0
Post image

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #loadedsweetpotatohashwithchilicrispeggs #loaded #sweet #potato #hash #with #chili #crisp #eggs #large #olive

0 0 0 0
Preview
Chili : José Antonio Kast, le nouveau président d’extrême droite qui tronçonne à tout va Depuis sa prise de fonction, le 11 mars, le nouveau président du Chili, José Antonio Kast, est sur tous les fronts. Le dirigeant d’extrême droite multiplie les ...

#Politique. #Chili : José Antonio #Kast, le nouveau président d’ #extrême #droite qui tronçonne à tout va

www.courrierinternational.com/article/poli...

0 0 0 0
Post image

We all know Brisket Chili tastes better in a Yeti

#bbq #chili #brisket #yeti #backyardbbq #bbqfriend

0 0 0 0
Preview
Chili : Il ne faut pas gracier d’anciens carabineros et responsables de l’armée - AMNESTY FR Le président José Antonio Kast a déclaré le 12 mars 2026 qu’il était possible qu’il accorde une grâce à d’anciens carabineros (police nationale en uniforme) et responsables de l’armée, qui […]

#Chili : Il ne faut pas gracier d’anciens carabineros et responsables de l’armée.

#AmnestyInternational #droitshumains

4 2 0 0
Post image

Stratégie de sécurité nationale 2025, les USA deviennent une forteresse civilisationnelle www.vers2045.com/20/03/2026/s...
#Brésil #Pérou #Chili #Argentine #Equateur #Colombie #Venezuela #Paraguay #Honduras #Uruguay #Bolivie #Guyana #Mexique

1 0 0 0