Do Chili or Nick Cannon deserve a pass? youtu.be/Bkep5qQPMS4?... #chili #nickcannon #trump #maga #upstander #envogue #saltnpepa
Darwin : la révolution qui a tout bousculé www.vers2045.com/19/03/2026/d...
#Brésil #Pérou #Chili #Argentine #Equateur #Colombie #Venezuela #Paraguay #Honduras #Uruguay #Bolivie #Guyana #Mexique
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable
#Chili from #TLC is getting dragged after being exposed as a Trump supporter. #BreakingNewsWithBranden
www.tiktok.com/t/ZP8bWkJtf/
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large
At only about 200 calories, this bowl packs a satisfying, super healthy punch. Quinoa Vegetarian Chili. A tasty, nutritious Meatless Monday Meal! RECIPE HERE: www.rockrecipes.com/quinoa-veget...
#quinoa #quinoarecipes #chili #healthyeating #healthyfood #healthylifestyle #weightloss #healthy
#NickCannon #Chili youtu.be/_H0fQhjGs8g?...
#TLC #Chili (Rozonda Thomas) has a decades long history of making really bad choices… This includes her current “MAGA BOO THANG”; Matthew Lawrence who hasn’t starred in a decent film or television show, in years…
#Chili is a big lying MAGA Trump fan!
Look at ALL 3 REPOSTS...
@joyannreid.bsky.social @donlemonofficial.bsky.social @rolandsmartin.bsky.social
youtube.com/post/Ugkxs0B...
#CHILI still getting dragged as MORE RECIEPTS are found ...
@accesshollywood.bsky.social @joyannreid.bsky.social
An apology public to Mrs Obama would have been better than bring caught in all these damned lies!
youtube.com/post/Ugkxs0B...
A purple labeled pint can shows a horned red eyed frog sticking out its red tongue with bold white lettering. A snifter glass full of dark ruby ale is to the right, bathed in bright sunlight
66F sunny, just a beautiful day. So who brought me this cold bug? Let’s burn that gunk out of my head.
#hoppinFrog BA Bite of the Beast #barleywine
Chili punch, full bodied caramel & vanilla with a hot bourbon finish. 18.8%!!
Wait, my nose is running…
#itsWorking #craftbeer #chili #bSkyBeer
Slow progress. But progress. #chili
NOT SHOCKED!
🤦🏽♀️🎶🤦🏽♀️🎶🤦🏽♀️🎶🤦🏽♀️
#Chili of #TLC fame has a decades long pattern of making really bad decisions…
52 Weeks of Cooking: Week 13 - Chilis
Chilis in our chili
#52weeksofcooking #reddit #cooking #challenge #chilis #chili #homemade #food
#FoodSky
#What'sCooking
#Chili
#Vegetables
#Vegan
#Homemade
🍽️🍜
Seemed like a vegetable chili day...and voilà. Extra-sharp cheddar, lots of spice, a bit of lime. 👍🍲❤️
Hatch chile red wine in New Mexico, USA. Well, you know, when in Rome! I wasn't sure how it would taste, but it was delightful! And very, as they say in the UK, "moreish". I bought several more bottles that week #hatch #chili #chile #redwine #newmexico #food #wine #travel #chilipepper #spicy
Why Anthony Kiedis Vanished After Hillel Slovak Died In the Netflix documentary The Rise of the Red Hot Chili Peppers: Our Brother, Hillel, Anthony Kiedis revisits one of the most painful chapters ...
#March #2026 #Anthony #Kiedis #Hillel #Slovak #Red #Hot […]
[Original post on societyofrock.com]
Dags att så c flexuosum. En chilisort som är frosthärdig. Jag har tre plantor i växthuset så nu skall det bli fler genetiskt skilda plantor.
Den kan inte pollinera sig själv så det krävs olika plantor för att det skall bli frukt
#chili #odla #flexuosum #lilltorp #gårdsliv
I did a hot dog again but a little differently. I was inspired by the new spring season. Ziti is attacking the bags again. #Hotdogs #baseball #chili #cooking #CookingSky #TheOutpost
ko-fi.com/Post/The-Bal...
L’intelligence artificielle : le moteur de la robotique chinoise www.vers2045.com/25/03/2026/l...
#Brésil #Pérou #Chili #Argentine #Equateur #Colombie #Venezuela #Paraguay #Honduras #Uruguay #Bolivie #Guyana #Mexique
Some like it hot!
#potholder #mugrug #cooking #hotpad #baking #chili #coasters #handmade #Chipotle #drinkmat #peppers #hotpeppers #freeshipping @2Fun4Words
etsy.me/3DA8RS4
I just made the greatest bowl of chili ever in the world. This is not up for debate. It is fact. No, you can't have any. You will take my word for it and praise me accordingly.
Thank you for your attention in this matter.
#foodsky #chili
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #loadedsweetpotatohashwithchilicrispeggs #loaded #sweet #potato #hash #with #chili #crisp #eggs #large #olive
#Politique. #Chili : José Antonio #Kast, le nouveau président d’ #extrême #droite qui tronçonne à tout va
www.courrierinternational.com/article/poli...
We all know Brisket Chili tastes better in a Yeti
#bbq #chili #brisket #yeti #backyardbbq #bbqfriend
#Chili : Il ne faut pas gracier d’anciens carabineros et responsables de l’armée.
#AmnestyInternational #droitshumains