Loving the new FitFlow update. Just type in your meal description and boom – instant nutrition info, pic, macros. So quick for daily tracking. #fitflowapp #nutrition

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #kimchibulgogimushroomtacoswithgochujangcrema #kimchi #bulgogi #mushroom #tacos #with #gochujang #crema #flour

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #ubecoconutstickyriceparfaitwithmango&toastedcoconut #coconut #sticky #rice #parfait #with #mango #toasted #sweet #fresh

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #mediterraneanchicken'shawarma'flatbreadswithwhippedhummus #mediterranean #chicken #'shawarma' #flatbreads #with #whipped #hummus #mini #mixed

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #yuzumisosalmon'sushi'burritobowl #yuzu #miso #salmon #'sushi' #burrito #bowl #cooked #avocado #spicy

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #snack #snackideas #healthysnack #snacktime #crispy'flamin'hot'chickenbiteswithavocadocrema #crispy #'flamin' #hot' #chicken #bites #with #avocado #crema #light

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #spicychipotleturkeymeatballdeconstructedbowl #spicy #chipotle #turkey #meatball #deconstructed #bowl #lean #ciabatta #mixed

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #gochujangglazedscallopskewerswithcrispykimchiquinoa #gochujang #glazed #scallop #skewers #with #crispy #kimchi #quinoa #cooked

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #lunch #lunchideas #lunchrecipe #midday #lemonherbstuffedbellpeppers #lemon #herb #stuffed #bell #peppers #feta #ricotta #breadcrumb

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #nashvillehotchickensushibake #nashville #chicken #sushi #bake #cooked #creamy

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #spicymiso'butter'udonwithcrispytofu #spicy #miso #'butter' #udon #with #crispy #tofu #extra-firm #vegan

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #crispychiligarlicshrimp&polentafries #crispy #chili #garlic #shrimp #polenta #fries #cooking

The FitFlow app just updated with a neat feature: type your meal/recipe, get instant picture, calories, macros, dietary info. Seriously speeds up logging. Pretty cool! #fitflowapp #nutrition #easytracking

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #creamygochujangsalmon&crispykimchiricebowls #creamy #gochujang #salmon #crispy #kimchi #rice #bowls #cooked

Just found a super handy feature in FitFlow! You type your meal, and it pops up with a picture and all the nutrition details (calories, macros, etc.) instantly. Makes tracking so much quicker and easier. #FitFlowApp #HealthyHabits #FoodTracking

FitFlow's new meal logging is wild. Type your food, get a pic, calories, macros, all instantly. Makes tracking a breeze. #FitFlowApp #nutrition

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #applecinnamonproteinbakedoatswithpecanstreusel&greekyogurtdrizzle #apple #cinnamon #protein #baked #oats #with #pecan #streusel #greek #yogurt #drizzle #rolled

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #applecinnamonproteinbakedoatswithpecanstreusel&greekyogurtdrizzle #apple #cinnamon #protein #baked #oats #with #pecan #streusel #greek #yogurt #drizzle #rolled

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #mediterraneanlentil'meatball'&orzoskewerswithlemonherbdressing #mediterranean #lentil #'meatball' #orzo #skewers #with #lemon #herb #dressing #cooked #mixed #olive

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #mediterraneanlentil'meatball'&orzoskewerswithlemonherbdressing #mediterranean #lentil #'meatball' #orzo #skewers #with #lemon #herb #dressing #cooked #mixed #olive

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #peruvianajiamarillochicken&quinoabowlswithcrispyplantains #peruvian #amarillo #chicken #quinoa #bowls #with #crispy #plantains #plantain #vegetable

Just tried out FitFlow's new text-to-nutrition feature and it's surprisingly good. Type your meal, get all the info instantly. Makes logging so much faster. Big fan! #fitflowapp #nutritiontracker

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #peruvianajiamarillochicken&quinoabowlswithcrispyplantains #peruvian #amarillo #chicken #quinoa #bowls #with #crispy #plantains #ripe #olive

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable

FitFlow just dropped a new feature where you can type your meal/recipe and get an instant pic, calories, macros, and all the dietary info. This is actually super convenient for quick tracking. #fitflowapp #mealtracking

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #lunch #lunchideas #lunchrecipe #midday #smashburgerquesadillaswithdillpickleaioli #smash #burger #quesadillas #with #dill #pickle #aioli #lean #large #shredded

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #lunch #lunchideas #lunchrecipe #midday #smashburgerquesadillaswithdillpickleaioli #smash #burger #quesadillas #with #dill #pickle #aioli #lean #large #shredded

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #spicyharissahoneychicken&datetagineinspiredbowl #spicy #harissa #honey #chicken #date #tagine-inspired #bowl #whole #medjool #olive

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #spicyharissahoneychicken&datetagineinspiredbowl #spicy #harissa #honey #chicken #date #tagine-inspired #bowl #whole #medjool