Filipino-style beef picadillo with olives, raisins, and root vegetables, in a Dutch oven pot on the stovetop

Work #MealPrep @coffeespots.ca Filipino-style beef picadillo with plenty of stuffed olives, over fluffy basmati rice; guilty pleasure ham salad w/ chopped cornichons sandwich on cheap commercially-made soft white bread; amazing potato and egg salad; cantaloupe chunks; banana/vanilla yogourts 🚑🐴🍽️

Prepped some side dishes this morning.
Spinach seasoned with sesame and kinpira gobo with konjac.
I love my MUJI containers—they’re simple, easy to wash, and look great!🫶🥹

#青空ごはん部
#FoodSky
#MealPrep
#SideDishes
#JapaneseFood
#MUJI

@bskyphotos.bsky.social

Pork Kaldereta Bola-bola Recipe This Pork Kaldereta Bola-bola recipe is an interesting way to make meatballs into a tasty dish. Bola-bola is Filipino for meatballs.

Leftovers? Tastes better tomorrow. Flavors intensify.
#food #recipes #MealPrep #NextDayMagic

Homemade lemon curd, from scratch - made by Aimee at www.hopeyourehungry.co.uk.

Homemade lemon curd, just after straining, & sterilized jars in the background, ready for filling - made by Aimee at www.hopeyourehungry.co.uk.

Homemade lemon curd on the left & on the right, oven-roasted tomatoes in olive oil (perfect for bruschetta or scrambled eggs on toast with a side of bacon) - made by Aimee at www.hopeyourehungry.co.uk.

Happy #Thursday lovely Hungrys! It's been a busy day of meal prep, including a small batch of homemade lemon curd, oven roasted tomatoes & there might be a lasagne later (when I've cleaned up). Time for a cuppa! Stay hungry! ;) x #bakeithappen #mealprep #cooking #lemoncurd #homemade

TASTIEST High Protein Crispy Steak Fried Rice!🔥🥩🥡 ONLY 585 calories with 54g Protein! #mealprep

Eating well gets easier when the process stops fighting you. It helps make meal planning feel more usable in real life. Try it free at munchinit.com. #healthhabits #fitlifestyle #balancedmeals #mealprep #proteinmeals

Quick & Healthy Lunch Alert!
Mediterranean Chicken Salad Wraps for a nutritious meal ready in no time! 🥗✨
Mix cooked chicken, cherry tomatoes, cucumber, red onion, feta, olives, & dressing. 💪🥙
#HealthyLunch #MealPrep #GaaSCloud

My fav recipe 🤤 follow me for more meal prep tips!

#gay #gayjock #mealprep #bottom

Roasted Pork Loin with Herb Root Vegetables A comforting and savory roasted pork loin served with a medley of tender herb-infused sweet potatoes, carrots, turnips, and onions, perfect for a hearty meal prep.

New meal prep alert! 🔥 This week's recipes feature hearty pork loin, beef stew, spicy chicken curry, and a vibrant veggie & chickpea bowl. Delicious and budget-friendly! #MealPrep #HealthyEating #WeeklyMeals

#MealPrep Live

7-day Mediterranean diet For weight loss in 2026 Stay fit and healthy with simple workout plans, diet tips, and wellness advice. Explore easy ways to improve your lifestyle in the USA.

Ready to transform your health with the world’s most celebrated way of eating?
The Mediterranean Diet isn't just a meal plan; it's a science-backed
befitandhealthy26.blogspot.com/2026/04/7-da...
#MediterraneanDiet #HealthyEating #WeightLossJourney #MealPrep #HeartHealth #CleanEating #WellnessTips

Day 20
I did not wanna get out of bed again this morning, I'll blame it on the snow we're supposed to get the rest of this week. But I'm still showing up and doing the thing lol. Did my walk and extra workouts, worked then made supper, which was very yummy! #workout #motivation #food #mealprep #walk

I think this was the last little bit of the remaining sides I had this over this weekend. Don't worry, I've made new sides for the start of this new work week.

#bentobox
#mealprep
#homecooking
#cozymeal
#neurodivergent

🍜 Carrot Muffins that taste like carrot cake but weekday friendly: Greek yogurt, applesauce, oats, banana, and shredded carrots make them super moist and meal prep perfect. Bake 15 to 18 min at 375°F
tastesbetterfromscratch.com/carrot-muffi...
#Muffins #Baking #Breakfast #MealPrep #CarrotCake #Snack

Trying to eat better is a lot easier when the planning part is less chaotic. Munchinit helps build smarter meals, match them to your goals, and turn them into a plan you can actually use. Start free at munchinit.com #mealplanning #healthyeating #nutrition #mealprep #fitness

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #applecinnamonproteinbakedoatswithpecanstreusel&greekyogurtdrizzle #apple #cinnamon #protein #baked #oats #with #pecan #streusel #greek #yogurt #drizzle #rolled

munchinit — AI Meal Planner AI-powered meal planning. Get a full 7-day meal plan with macros, grocery list and recipes in seconds.

Trying to eat better is a lot easier when the planning part is less chaotic. Munchinit helps build smarter meals, match them to your goals, and turn them into a plan you can actually use. Start free at munchinit.com #mealplanning #healthyeating #nutrition #mealprep #fitness

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #applecinnamonproteinbakedoatswithpecanstreusel&greekyogurtdrizzle #apple #cinnamon #protein #baked #oats #with #pecan #streusel #greek #yogurt #drizzle #rolled

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #mediterraneanlentil'meatball'&orzoskewerswithlemonherbdressing #mediterranean #lentil #'meatball' #orzo #skewers #with #lemon #herb #dressing #cooked #mixed #olive

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #mediterraneanlentil'meatball'&orzoskewerswithlemonherbdressing #mediterranean #lentil #'meatball' #orzo #skewers #with #lemon #herb #dressing #cooked #mixed #olive

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #peruvianajiamarillochicken&quinoabowlswithcrispyplantains #peruvian #amarillo #chicken #quinoa #bowls #with #crispy #plantains #plantain #vegetable

BCC+ membership promo image with cream background and veggies bold unlock BCC+ message

Less scrambling. More confidence in the kitchen 🥦
BCC+ is where the planning tools and printable guides live, all ad-free. www.binkysculinarycarnival.com/join-our-mem...

#bccplus #cookwithconfidence #mealprep #realfoodathome

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #peruvianajiamarillochicken&quinoabowlswithcrispyplantains #peruvian #amarillo #chicken #quinoa #bowls #with #crispy #plantains #ripe #olive

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable

Chicken curry 🍛 from the #MealPrep #DinnerVibes

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #lunch #lunchideas #lunchrecipe #midday #smashburgerquesadillaswithdillpickleaioli #smash #burger #quesadillas #with #dill #pickle #aioli #lean #large #shredded

Almost set up! Stop by and hang out!
Still feeling kinda tired so we're not going to go too crazy today.

#vtuber #cutekumavt #indiegame #mealprep #demo