9 Foods That Stop Memory Loss & Fight Dementia In Over 50s According to Neurologists (They Give Your Brain a Boost) | Flipboard yourlifestylelibrary.com - Tell me if any of this sounds familiar. You walk into a room and forget why you went in there. You lose a word mid-sentence. You spend three minutes …

flip.it/VFcNH0 What you put on your plate has a measurable effect on how well your brain functions. #flipboardusergroup #healthylifestyle #lifestyle #aging #healthyeating #dementia #memoryloss #agingbrain #brain #memory #gettingolder

Follow @biohackingpathway for more

#healthyeating #sugarshock #bodymaintenance #healthylifestyle #diet #nutrition #wellbeing #fitness #wellbeingwarrior #wellnes #wellbeingcoach #wellnessblog #wellnesswins #weightloss #healthtips

Want seafood you can enjoy often without worry? Go for low-mercury choices that still deliver big nutrition. Salmon and sardines offer omega-3s for heart and brain support, plus quality protein for the whole family. Skip the big predators and eat with confidence. #healthyfood #healthyeating

Tilda Inspires You to Make Every Meal Meaningful Nationwide campaign set to launch across TV, online, radio, and podcasts to connect with shoppers and highlight quality ingredients

Tilda's 'Live Like You Mean It' campaign aims to make everyday meals special

#TildaRice #LiveLikeYouMeanIt #FoodCampaign #EverydayMeals #MindfulEating #MealInspiration #FoodLovers #HomeCooking #HealthyEating #FoodieMoments #CulinaryJoy

www.easterneye.biz/tilda-live-l...

6 Everyday Foods That Are Ultra-Processed—Even Though They Seem Healthy Nutrition experts explain what ultra-processed foods are, and that they aren't inherently bad, but you might want to limit or avoid them. They also share surprising foods that are ultra-processed, suc...

Do you know what an ultra processed food is--and how to make a healthier version of it you'll actually eat? @uncg.edu Nutrition Professor Amy Moyer tells you what foods seem good-for-you but aren't, and how to make them more nutritious. #healthyeating #nutrition
https://bit.ly/4s22sG7

Trying to eat better is a lot easier when the planning part is less chaotic. Munchinit helps build smarter meals, match them to your goals, and turn them into a plan you can actually use. Start free at munchinit.com #mealplanning #healthyeating #nutrition #mealprep #fitness

#healthyeating #DinnerForBreakfast #BloodSugar #BreakfastAlternatives #HealthyEating #GlucoseControl #MetabolicHealth #NutritionTips #wellbeingmatters #wellnessinfluencer #healthyageing #WeightLoss #HealthyLifestyle #FoodRevolution

#healthyeating
#photography

Playing with complex protein combos
- pasta is tricky - actual serving size per box

Nuts, smoothies, avocados, granola; nutrient-dense but also calorie-dense. GLP-1s help appetite, but they don’t cancel calories. Awareness still matters. #glp1 #fatloss #nutritionmatters #nutritiontips #healthyeating #glp1weightloss #glp1doctor #glp1health #glp1forweightloss

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #applecinnamonproteinbakedoatswithpecanstreusel&greekyogurtdrizzle #apple #cinnamon #protein #baked #oats #with #pecan #streusel #greek #yogurt #drizzle #rolled

munchinit — AI Meal Planner AI-powered meal planning. Get a full 7-day meal plan with macros, grocery list and recipes in seconds.

Trying to eat better is a lot easier when the planning part is less chaotic. Munchinit helps build smarter meals, match them to your goals, and turn them into a plan you can actually use. Start free at munchinit.com #mealplanning #healthyeating #nutrition #mealprep #fitness

📬Preventia’s March Newsletter is out! 👇

mailchi.mp/f5a2a5ab6cbf...

🥗Stay ahead with the latest studies, news, events, and EU regulatory updates on NCDs, nutrition, and health

👉To subscribe: shorturl.at/uJqwb

#HealthierTogether #PreventNCDs #healthyeating

@ec.europa.eu

'Shameful' number of families in Wales can't afford healthy food A food charity said more healthy foods cost more than twice as much as less healthy options, causing huge challenges for families on low incomes

'Shameful' number of families in Wales can't afford healthy food
#Wales #Cymru #Health #Healthyeating #WelshGovernment #Politics #Family&Kids
www.walesonline.co.uk/news/wales-news/shameful...

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #applecinnamonproteinbakedoatswithpecanstreusel&greekyogurtdrizzle #apple #cinnamon #protein #baked #oats #with #pecan #streusel #greek #yogurt #drizzle #rolled

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #mediterraneanlentil'meatball'&orzoskewerswithlemonherbdressing #mediterranean #lentil #'meatball' #orzo #skewers #with #lemon #herb #dressing #cooked #mixed #olive

#LiverHealth #GutHealth #UltraProcessedFood #ModernDiet #AutoimmuneDisease #Type2Diabetes #FattyLiver #LeakyGut #HealthyEating #Podcast

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #mediterraneanlentil'meatball'&orzoskewerswithlemonherbdressing #mediterranean #lentil #'meatball' #orzo #skewers #with #lemon #herb #dressing #cooked #mixed #olive

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #peruvianajiamarillochicken&quinoabowlswithcrispyplantains #peruvian #amarillo #chicken #quinoa #bowls #with #crispy #plantains #plantain #vegetable

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #peruvianajiamarillochicken&quinoabowlswithcrispyplantains #peruvian #amarillo #chicken #quinoa #bowls #with #crispy #plantains #ripe #olive

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #lunch #lunchideas #lunchrecipe #midday #smashburgerquesadillaswithdillpickleaioli #smash #burger #quesadillas #with #dill #pickle #aioli #lean #large #shredded

Healthy breakfast, fast:
- Greek yogurt + berries + chia
- Oats + peanut butter + banana + cinnamon
- Eggs + avocado + whole‑grain toast
- Spinach–mango protein smoothie + flax
Formula: protein + fiber + healthy fats + color. #HealthyEating #Breakfast

At only about 200 calories, this bowl packs a satisfying, super healthy punch. Quinoa Vegetarian Chili. A tasty, nutritious Meatless Monday Meal! RECIPE HERE: www.rockrecipes.com/quinoa-veget...

#quinoa #quinoarecipes #chili #healthyeating #healthyfood #healthylifestyle #weightloss #healthy

Looking for a spicy vegetarian soup? M Quick Curried Cauliflower Soup is packed with flavour and nutrition! Perfect for any day of the week. 🌱🥘 #HealthyEating #VegetarianRecipes #Cauliflower

#photography
#healthyeating

Very still morning-

Big picture seems to be completely out of focus
if you do not value yourself,
your life,
how do you bear responsibility for others...?

"Ownership" is not care

Clearly a crisis of values-

If you are not even humane-

How is life for you?

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #lunch #lunchideas #lunchrecipe #midday #smashburgerquesadillaswithdillpickleaioli #smash #burger #quesadillas #with #dill #pickle #aioli #lean #large #shredded

#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #dinner #dinnerideas #dinnerrecipe #weeknightdinner #spicyharissahoneychicken&datetagineinspiredbowl #spicy #harissa #honey #chicken #date #tagine-inspired #bowl #whole #medjool #olive

Murakami Farm Taiwan Licensing Business Gains Momentum As Sprout Sales Double KUALA LUMPUR, March 30 (Bernama) — Murakami Farm Co Ltd announced that sales of its “Broccoli Super Sprouts”, produced under licence by Taiwanese company Greenvines, doubled year-on-year in fiscal year 2025 (FY2025), marking rapid progress in the company’s first overseas licensing venture. Boasting the top market share of sprouts in Japan, Murakami Farm entered into a licence agreement for the production and sales of sprout products with Greenvines in the Taiwan region in 2021, with shipments beginning in 2022. The strong growth is attributed to the combination of increasing health awareness among local people and high confidence in the Japanese […]

Murakami Farm Taiwan Licensing Business Gains Momentum As Sprout Sales Double #MurakamiFarm #Sprouts #TaiwanBusiness #HealthyEating #Licensing