#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #ubeswirlpancakeswithcoconutcream&toastedmochi #swirl #pancakes #with #coconut #cream #toasted #mochi #all-purpose #large #granulated #vegetable
PATTI LABELLE’S GOOD LIFE PANCAKE MIX IS THE BEST. IT IS AVAILABLE AT KROGER, WHERE THEY HAVE A FLORAL CLEARANCE
SECTION.
#RIANNJENKINS #DEALS #FYP #PANCAKES #FLOWERS
Inktober 52 Week 12: “Covered”
Uh ohs! Pancake the cat is covered in pancakes! And the pancakes are covered in blueberries!! AND the blueberries are covered in butter and syrup!!!
#inktober52covered @inktober #inktober2026 #inktober #cat #pancakes
A pancake in the form of a penguin, on a white dinner plate. There are no toppings on the pancake.
There's a gadget for everything, though maybe not space in the kitchen for them 😀
#AlphabetChallenge #WeekNforNonsense #pancakes
We tapped our tree on March 10th and finished up on April 4th.
The speed of the drip from the tree is dependent on the temperature. Warmer temp then faster drip.
We had 4 boiling down days in between all the days of gathering sap. It took hours each boiling day to boil down the sap to maple syrup.
The final result of this container being filled to the top 2 times with sap ended with this small amount of maple syrup.
A bit of a fun project this spring. This is the amount of maple syrup we produced from our single maple tree this year. A single tree, we are told, can yield .75 to 1.5 liters of pure maple syrup. So I think we did okay and look forward to our first #Pancakes. #MadeinCanada #maplesyrup #Ontario
Dit is echt een guilty pleasure #pancakes 🍽️
i love ihop #pancakes
Sunday breakfast. Chocolate chip pancakes and bubbles!
I love Sunday breakfast. #WineisLove #bubbles #pancakes
Isabelle brut
Pickle & Rye - East Sheen @pickleandrye #pickleandrye #eastsheen #food #london #pancakes
Had to have a dessert
#pancakes
#crepes
#Paris
#Bretonclassic
Picture of Nolan Rose cooking pancakes at the Eleanor Easter Breakfast.
Making some pancakes 🥞 for the Easter breakfast #eleanorwv #easterbreakfast #pancakes
Pancake Animals: Blueberry Dalmatian in double knit form! 🐶 🫐
This is currently being made with chenille yarn, so stay tuned. After my Easter break, a crochet pattern of the three animals will be released.
#crochet #amigurumi #pancakes #dog
Damn... as April started, I caught a stupid cold.... now this... At least I can treat myself to these delicious breakfasts.
🤧😋🥞🥛 #Pancakes #Breakfast #Cold
I found a new recipe for Pancakes.
Guilt free pancakes. We'll, almost. Pancake mix or flour and stuff if yah wanna go scratch. A cup of vanilla Greek yogurt 13 grams protein. Two eggs and milk. Go easy on the butter and pure maple syrup (Sure Jan!) And it's actually good for you. I'll keep repeating that as I eat them.
#pancakes
Go ahead and do your best impression of what this means in the comments. #versuswolves #supereyepatchwolf #woolievs #japan #language #linguistics #pancakes #mickeymouse
Casa Lima, San Jose, Costa Rica #pancakes
Ok, Ik I said I wouldn't post again, but then I read Eni's account.... Sorry-
plushie kate's account @enigmaverse.bsky.social
So....lazy, but here is Eni pancakes.
tags:
#comic #Enigmaverse #fanart #Silly #Pancakes #Eni #Kate #lazy
Dit is echt een guilty pleasure #pancakes 🍽️
These wavering feelings,
they’re all still part of love, I think.
#EggsBenedict #CoffeeTime #Pancakes
#HalfAndHalf #BrunchDate #CafeMood
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #large #vegetable
#fitflow #fitflowapp #recipe #foodie #healthyeating #mealprep #breakfast #breakfastideas #morningmeal #breakfastrecipe #highproteinsavorykimchipancakeswithchilicrispdrizzle #high-protein #savory #kimchi #pancakes #with #chili #crisp #drizzle #all-purpose #whey #large
#caption #contest #captionthis #captions wanted #captionsplease #captionsforinsta #captionsplus #storyprompt #storyprompts #wrongway #wrongturn #wrongnumber #wrongplace #wrongplacewrongtime #wronganswer #wronganswers #wronganswersonly #breakfast #pancakes
A big staple of thin pancakes, next to them cut up strawberries, quark, lemon curd, bananas and other things in bowls, glasses, and other containers.
We had friends over yesterday (remember the grand piano to be turned into a shelf? The work is progressing...), so I made one of the most comfort meals possible: pancakes! The East-European unleavened version (blini).
One of my favourite toppings is quark […]
[Original post on mastodon.social]
Pumpkin pancakes with onion eggs and fresh blueberry "jam." Happy Saturday!
#pancakes #blueberries #Saturday