#TRT #HormoneHealth #LowTestosterone #BHRT #HormoneBalance #MensHealth #WomensHealth #MentalHealthCare #KetamineTherapy #AnxietyHelp #DepressionSupport #Inflammation #Autoimmune #Insomnia #SleepHealth #BoiseHealth #IdahoCare #FunctionalMedicine

The Melatonin Gummy Scam Explained #deception #sleep #SleepHealth #SleepTips

Sleep Ignored? Why?

Adequate rest is important for restoring vitality and supporting high-level performance, achievement, and enjoyment of life. youtube.com/shorts/SVX_s...
#SleepHealth, #Recovery, #PeakPerformance, #Wellness, #Energy

survivor50's double elimination twist highlights how acute stress and team dynamics affect mental resilience, drágám. Reminder: debrief, rest, and keep checking in on each other after big events—

#MentalHealth #HealthTech #SleepHealth

Evening light exposure can disrupt sleep and should generally be avoided.
#SleepHealth

waking from a nap with chest tightness or breathlessness is often shrugged off. Ngl, poor sleep and skipped recovery can hide heart attack warnings, if night symptoms appear, get checked.

#SleepHealth #HealthTech #HeartDisease

clavicular? Smirkmaxxer mogged them and now we're handing out Pulitzers to bones, I'm caffeinated and profoundly confused. 🫠

#MentalHealth #SleepHealth #MedTwitter

Performance of wearable light sensors for measuring photopic and melanopic illuminance under laboratory and free-living conditions Abstract. Wearable sensors are commonly used to study the effects of free-living light exposure on physiological outcomes; however, rigorous validation of

#Wearabletechnology have revolutionized the way we study #sleephealth and the many things it affects. In this article #wearables replace #actigraphs to measure #photopicluminance and #melantopicluminance in and out of the lab. 🧪

academic.oup.com/sleep/articl...

🏋️‍♀️ Aligning your exercise timing with whether you are a 'morning person' or 'night person' could help protect your ticker from heart disease, as well as help boost your sleep quality,

buff.ly/3cWXQN8

#science #sciencenews #exercise #fitness #nightowl #morninglark #hearthealth #sleephealth

📅 Published on: February 11, 2022
📄 Full Study: [DOI: 10.1007/s43657-021-00039-6] 🔗
#CircadianRhythm #LightResearch #SleepHealth #BiomedicalEngineering #Chronobiology

#TRT #HormoneHealth #LowTestosterone #BHRT #HormoneBalance #MensHealth #WomensHealth #MentalHealthCare #KetamineTherapy #AnxietyHelp #DepressionSupport #Inflammation #Autoimmune #Insomnia #SleepHealth #BoiseHealth #IdahoCare #FunctionalMedicine

Post-infection sleep syndrome: long COVID as an example Infections can directly or indirectly damage the nervous system. The post-infection syndromes are especially challenging, as the range of clinical syndrome

The effects of #disease can linger long after you're healed. #COVID-19 is one such example, with #longCOVID shown to have lingering impacts on #memory and #respiratoryhealth. 🫁 In this paper, #longCOVID's impact on #sleephealth is explored.

academic.oup.com/sleep/advanc...

Sen. Nilo renews push to end clock switching, citing health benefits; golf groups urge broader study SB 1197 would move California to permanent standard time to eliminate the twice‑yearly clock change. A sleep medicine physician testified that the switch harms sleep and cardiovascular health; golf and recreation groups urged careful study of economic and safety impacts.

Sen. Nilo is pushing to end the disruptive clock changes in California, citing significant health risks and urging a move to permanent standard time—could this be the change we all need?

Click to read more!

#CA #CitizenPortal #EconomicImpact #PublicSafety #SleepHealth

Association of clinical, psychological, and lifestyle factors with disparities in sleep: the CARDIA sleep study AbstractStudy Objectives. To determine the degree to which clinical, psychosocial, and lifestyle factors are associated with racial disparities in sleep he

The #CoronaryArteryRiskinYoungAdults (CARDIA) study analyzed 7 days of wearable #actigraph data and #questionnaires from 899 #middle-aged participants. The goal was to uncover which clinical, psychosocial, and lifestyle factors are most closely linked to #racialdisparities in #sleephealth.

Why Modern Life Is Ruining Your Sleep?😴😴⁣
⁣
⁣
⁣
#sleephealth #circadianrhythm #bluelight #hormonehealth #sleepdeprivation #technologyimpact #modernlifestyle #outdoorhealth #naturallight #sleepbetter #healthyliving #sleepquality #lifehacking #biohacking

I stick to health, not my lane, sorry.

#Cardiology #MentalHealth #SleepHealth

It can seek to integrate #sleephealth and methodological advances into global #climate and #health monitoring systems and economic assessments, and to translate these findings into scalable action.

#TRT #HormoneHealth #LowTestosterone #BHRT #HormoneBalance #MensHealth #WomensHealth #MentalHealthCare #KetamineTherapy #AnxietyHelp #DepressionSupport #Inflammation #Autoimmune #Insomnia #SleepHealth #PocatelloHealth #IdahoCare #FunctionalMedicine

Normal ECGs are snapshots; arrhythmias and sleep-linked cardiac events can be missed, continuous monitoring like CHART finds them earlier—

#MedTwitter #SleepHealth #CardiacCare

tbh arsenal win tonight? Celebrate, then focus on sleep for your brain.

#Cardiology #MentalHealth #SleepHealth

The Secret to Muscle Gains? Sleep More 😴💪 ⁣⁣
⁣⁣
⁣⁣
⁣Follow @biohackingpathway for more⁣
⁣
⁣
⁣⁣
#health #musclegrowth #sleepforgains #fitness #bodybuilding #sleephealth #resistancetraining #protein #fitnessmotivation #healthtips #musclebuilding #recovery #sleepdeprivation

Blue light exposure in the evening suppresses melatonin production, delaying sleep onset and impairing recovery.
#SleepHealth

Follow @biohackingpathway for more

#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome

As a medical school professor, I teach that sleep matters for metabolism. But now we have the precise number.

A study of 23,475 adults published in BMJ Open Diabetes Resea... https://drc.bmj.com/content/14/2/e005692

#SleepHealth #InsulinResistance #Diabetes #MetabolicHealth #HealthLongevitySecrets

Multidimensional association of sleep health with dietary habits and physical activity in adolescents While insufficient sleep is associated with poor lifestyle factors, a multidimensional approach assessing multiple sleep health dimensions via subjective and objective measures has emerged as a more c...

Evaluar el sueño con un abordaje multidimensional aborda mejor su asociación con los factores del estilo de vida #actigraphy #adolescents #dietaryhabits #physicalactivity #Polysomnography #Sleephealth www.sleephealthjournal.org/article/S235...

4) Alcohol doesn’t just affect your body, impacts your sleep quality too😴Even small amounts can disrupt REM sleep, leaving you feeling less rested the next day. Over time, poor sleep can affect mood, memory, and overall health.🧠
#AlcoholAwarenessMonth #SleepHealth

Uykusuz Toplumlar, Düşük Refah mı? Küresel veriler uyku-ekonomi ilişkisini inceliyor. Kısa/kalitesiz uyku, üretkenliği azaltıp sağlık harcamalarını artırır. Uyku, ulusal bir yatırım! - #SleepEconomy #Productivity #GlobalData #Wellbeing #SleepHealth

TIRED AFTER 8 HOURS OF SLEEP THIS IS WHY YOUR BODY IS EXHAUSTED
#sleep #fatigue #health #hormones #cortisol #wellness #mentalhealth #burnout #sleephealth #doctor #healthtips #energy #stress #viralvideo #fyp

Your nighttime routine sets the tone for your next day. Better sleep starts with better habits!

#ImbibeSleep #BetterSleep #SleepWellness #SleepHealth #SleepUpgrade

Not all pillows fit all sleepers. Thick = more support. Thin = lower profile. The right fit makes all the difference!

#ImbibeSleep #BetterSleep #SleepWellness #SleepHealth #SleepUpgrade