Sen. Nilo renews push to end clock switching, citing health benefits; golf groups urge broader study SB 1197 would move California to permanent standard time to eliminate the twice‑yearly clock change. A sleep medicine physician testified that the switch harms sleep and cardiovascular health; golf and recreation groups urged careful study of economic and safety impacts.

Sen. Nilo is pushing to end the disruptive clock changes in California, citing significant health risks and urging a move to permanent standard time—could this be the change we all need?

Click to read more!

#CA #CitizenPortal #EconomicImpact #PublicSafety #SleepHealth

Association of clinical, psychological, and lifestyle factors with disparities in sleep: the CARDIA sleep study AbstractStudy Objectives. To determine the degree to which clinical, psychosocial, and lifestyle factors are associated with racial disparities in sleep he

The #CoronaryArteryRiskinYoungAdults (CARDIA) study analyzed 7 days of wearable #actigraph data and #questionnaires from 899 #middle-aged participants. The goal was to uncover which clinical, psychosocial, and lifestyle factors are most closely linked to #racialdisparities in #sleephealth.

Why Modern Life Is Ruining Your Sleep?😴😴⁣
⁣
⁣
⁣
#sleephealth #circadianrhythm #bluelight #hormonehealth #sleepdeprivation #technologyimpact #modernlifestyle #outdoorhealth #naturallight #sleepbetter #healthyliving #sleepquality #lifehacking #biohacking

I stick to health, not my lane, sorry.

#Cardiology #MentalHealth #SleepHealth

It can seek to integrate #sleephealth and methodological advances into global #climate and #health monitoring systems and economic assessments, and to translate these findings into scalable action.

#TRT #HormoneHealth #LowTestosterone #BHRT #HormoneBalance #MensHealth #WomensHealth #MentalHealthCare #KetamineTherapy #AnxietyHelp #DepressionSupport #Inflammation #Autoimmune #Insomnia #SleepHealth #PocatelloHealth #IdahoCare #FunctionalMedicine

Normal ECGs are snapshots; arrhythmias and sleep-linked cardiac events can be missed, continuous monitoring like CHART finds them earlier—

#MedTwitter #SleepHealth #CardiacCare

tbh arsenal win tonight? Celebrate, then focus on sleep for your brain.

#Cardiology #MentalHealth #SleepHealth

The Secret to Muscle Gains? Sleep More 😴💪 ⁣⁣
⁣⁣
⁣⁣
⁣Follow @biohackingpathway for more⁣
⁣
⁣
⁣⁣
#health #musclegrowth #sleepforgains #fitness #bodybuilding #sleephealth #resistancetraining #protein #fitnessmotivation #healthtips #musclebuilding #recovery #sleepdeprivation

Blue light exposure in the evening suppresses melatonin production, delaying sleep onset and impairing recovery.
#SleepHealth

Follow @biohackingpathway for more

#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome

As a medical school professor, I teach that sleep matters for metabolism. But now we have the precise number.

A study of 23,475 adults published in BMJ Open Diabetes Resea... https://drc.bmj.com/content/14/2/e005692

#SleepHealth #InsulinResistance #Diabetes #MetabolicHealth #HealthLongevitySecrets

Multidimensional association of sleep health with dietary habits and physical activity in adolescents While insufficient sleep is associated with poor lifestyle factors, a multidimensional approach assessing multiple sleep health dimensions via subjective and objective measures has emerged as a more c...

Evaluar el sueño con un abordaje multidimensional aborda mejor su asociación con los factores del estilo de vida #actigraphy #adolescents #dietaryhabits #physicalactivity #Polysomnography #Sleephealth www.sleephealthjournal.org/article/S235...

4) Alcohol doesn’t just affect your body, impacts your sleep quality too😴Even small amounts can disrupt REM sleep, leaving you feeling less rested the next day. Over time, poor sleep can affect mood, memory, and overall health.🧠
#AlcoholAwarenessMonth #SleepHealth

Uykusuz Toplumlar, Düşük Refah mı? Küresel veriler uyku-ekonomi ilişkisini inceliyor. Kısa/kalitesiz uyku, üretkenliği azaltıp sağlık harcamalarını artırır. Uyku, ulusal bir yatırım! - #SleepEconomy #Productivity #GlobalData #Wellbeing #SleepHealth

TIRED AFTER 8 HOURS OF SLEEP THIS IS WHY YOUR BODY IS EXHAUSTED
#sleep #fatigue #health #hormones #cortisol #wellness #mentalhealth #burnout #sleephealth #doctor #healthtips #energy #stress #viralvideo #fyp

Your nighttime routine sets the tone for your next day. Better sleep starts with better habits!

#ImbibeSleep #BetterSleep #SleepWellness #SleepHealth #SleepUpgrade

Not all pillows fit all sleepers. Thick = more support. Thin = lower profile. The right fit makes all the difference!

#ImbibeSleep #BetterSleep #SleepWellness #SleepHealth #SleepUpgrade

If you wake up hot, your pillow might be the reason. Temperature regulation helps you stay asleep longer and wake up more refreshed!

#ImbibeSleep #BetterSleep #SleepWellness #SleepHealth #SleepUpgrade

Why You Should Sleep in a Cold Room Why You Should Sleep in a Cold Room What's your biggest sleep struggle? 🔗 https://blog.boldlybalance.life/posts/why-you-should-sleep-in-a-cold-room.html #SleepHealth #BetterSleep #Wellness

Why You Should Sleep in a Cold Room

What's your biggest sleep struggle?

🔗 blog.boldlybalance.life/posts/why-you-should-sle...

#SleepHealth #BetterSleep #Wellness

Why Your Body Feels So Tired Even When You Rest All Day There are days when you wake up already tired. Not the kind of tired that sleep fixes. It feels deeper. Your shoulders feel heavy. Your back feels tight. Even small things start to feel like too much....

Why Your Body Feels Tired Even After Rest: Hidden Causes of Constant Fatigue Explained
View More: tinyurl.com/4urr23e9

#ChronicFatigue #AlwaysTired #LowEnergy #HealthTips #WellnessJourney #SleepHealth #StressManagement #HealthyLifestyle #MindBodyHealth #SelfCareRoutine #usa #fermarbranch

Why does Imbibe exist? Because better sleep changes everything. From energy to focus to recovery, what you sleep on matters!

#ImbibeSleep #BetterSleep #SleepWellness #SleepHealth #SleepUpgrade

Why does Imbibe exist? Because better sleep changes everything. From energy to focus to recovery, what you sleep on matters more than you think.

#ImbibeSleep #BetterSleep #SleepWellness #SleepHealth #SleepUpgrade

Improving sailor’s amount and efficiency of sleep in two-section watchkeeping schedules: A cluster randomized trial study AbstractStudy Objectives. The present study aimed at comparing sailors’ amount and efficiency of sleep in two two-section watchkeeping schedules, i.e. the

Sailors are plagued by #poorsleep due to their #schedules of #watchkeeping. This study tailors an #intervention using #twosectionwatchkeepingschedules to improve #sleephealth in #sailors. ⛴️

academic.oup.com/sleep/articl...

The Clocks Have Gone Forward: Should Daylight Saving Time Be Scrapped? The clocks have gone forward—but is daylight saving time doing more harm than good? Discover the hidden health risks, shocking research, and why exper

⏰ Did We Just Lose an Hour… for Nothing? 🤔

The clocks moved forward… but is Daylight Saving Time still worth it?

Some love longer evenings 🌇
Others say it hurts sleep and health 😴⚠️

👉 Read more: www.stories-all.online/2026/03/uk-t...

#DaylightSavingTime #DST #ClockChange #SleepHealth #UKNews

Self-improvement quote card

Your brain literally washes itself while you sleep. 🧠 Cells shrink by 60% to flush out toxins. Sleep isn't rest; it's deep cleaning. #SelfImprovement #PersonalGrowth #Mindset #Motivation #GrowthMindset #Neuroscience #SleepHealth #BrainPower #Biohacking #Wellness

Brain scans reveal how poor sleep fuels negative emotions in alcohol addiction Scientists have discovered that poor sleep amplifies negative emotions in individuals with alcohol use disorder. Imaging shows that insomnia activates neural networks linked to rumination, suggesting sleep treatments could greatly improve emotional well-being during recovery.

Brain scans reveal how poor sleep fuels negative emotions in alcohol addiction #Science #HealthandMedicine #MentalHealth #SleepHealth #AlcoholAddiction #MentalHealthResearch

www.psypost.org/brain-scans-reveal-how-p...

📅 29 maart 2026 – Zomertijd in Nederland! 🌞⏰
Vannacht gaat de klok in Nederland weer een uur vooruit: om 02:00 uur wordt het 03:00 uur. Vergeet dus niet je klok vooruit te zetten.
#Zomertijd #Brainfog #SleepHealth #Sarcoïdose #ChronischeZiekte

🛏️ Find Your Best Sleeping Position

Your sleep posture affects comfort, breathing, and spinal alignment. Learn which position works best for your body and improves sleep quality.

👉 eliandelm.com/best-sleepin...

#BetterSleep #SleepHealth #SleepTips

Sleep Builds Tomorrow’s Performance

Rest fuels resilience and clarity. Quality sleep multiplies daytime effectiveness. youtube.com/shorts/l6fp2...
#SleepHealth, #Recovery, #WellnessLifestyle, #BetterSleep, #HealthOptimization