#CentessaPharma is heading for an #acquisition by #EliLilly, which has offered $6.3 billion for the company, with another $1.5 billion in future payments tied to #FDA approvals of its lead drug for #sleepdisorders.
Consider therapeutic use of #cannabis ... #ResearchIsKey #medicalcannabis #cannabis #IBD #Crohns #chronicpain #glaucoma #epilepsy #cancer #MS #PTSD #anorexia #IBS #migrane #musclespasm #SleepDisorders #TouretteSyndrome #depression #addiction #Amyotrophiclateralsclerosis #Chemotherapy-inducednausea
Clinical practice recommendations for treatment of #restlesslegssyndrome ( #RLS) and periodic limb movement disorder ( #PLMD) in adults and pediatric patients.
doi.org/10.5664/jcsm...
#SleepDisorders
#PLMS
... growing evidence now highlights a bidirectional interplay: #sleep disruption is not only a consequence of neurodegeneration but also exacerbates its progression. Attenuating #sleepdisorders may therefore provide symptomatic relief & disease‑modifying effects for NDDs
💡 New research sheds light on the link between adult separation anxiety and #insomnia in individuals with mood and #AnxietyDisorders.
📖 Read more: www.sciencedirect.com/science/arti...
#ECNP #SleepDisorders #neuroscience @elsevierhms.bsky.social
Why Your Most Vivid Dreams Might Be the Key to Deep, Restful Sleep #Science #HealthandMedicine #SleepDisorders #SleepScience #DreamResearch #MentalHealth
scitechdaily.com/why-your-most-vivid-drea...
New in JMIR Aging: Dynamic Relationship Between Sleep Patterns and Behavioral and Psychological Symptoms of Dementia: Longitudinal Observational Study #Dementia #MentalHealth #SleepDisorders #CaregiverSupport #PsychologicalSymptoms
www.intercommunityct.org/prioritizing...
#intercommunity #goodnightsrest #sleepdisorders #prioritizesleep #connecticut
“We know in the period after you're active and get exercise, you can focus and make fewer errors.”
👉 Watch on ACAMH Learn · Free CPD/CME
#ChildMentalHealth #EvidenceBased #ADHD #SleepDisorders
Despite their massive impact on overall health and an economic burden in the hundreds of billions of Euros, sleep disorders remain critically neglected in public health strategies
Read the recently published article now: onlinelibrary.wiley.com/doi/10.1111/...
@ean.org #WileyNeuro
#SleepDisorders
Today is #WorldSleepDay — a reminder that sleep is essential for health and well-being.
A landmark 2006 National Academies report examined the widespread impact of #SleepDisorders and #SleepDeprivation and outlined recommendations to advance research: https://ow.ly/1EWP50YtF78
📣 Changing how we understand #sleepiness starts with awareness. When we recognize that sleepiness is a health signal, not a character flaw, we create more support for people navigating sleep challenges and #sleepdisorders.
➡️ Take action this #SleepAwarenessMonth: https://ow.ly/3V4n50YsP86
Oh no...
I just realized Daylight "Savings" Time starts this weekend.
My sleep disorders and I hate it with a white-hot passion!
#AbolishDST #sleepdisorders
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
tinyurl.com/483hv2yt
#TBI also can have long-term sequelae including #cognitive #dysfunction, #pain, #sleepdisorders and physical #disability collectively known as the #postconcussionsyndrome (#PCS)
tinyurl.com/2j2skhx4
For many veterans, #TBI does not exist in isolation. It often intersects with #posttraumaticstress, #sleepdisorders, #depression, #chronicpain.
A video about obstructive sleep apnea #OSA by Dr. Gold to watch before our 3/6/26 Clinician's Roundtable with him:
"Sleep Medicine Grand Rounds by Dr. Gold (2022)
Why Are OSA Patients Sleepy?" www.youtube.com/watch?v=7QpI...
#SleepDisorders #SleepMedicine
Dr. Avram Gold is a pioneer in researching links between #SleepDisorders, upper airway resistance syndrome #UARS, #MECFS, functional somatic syndromes #FSS
Topics he covers:
FSS, sleep-breathing disorders, central sensitivity syndrome, sleep-disordered breathing, stress, anxiety, depression, MECFS
New research shows low-dose opioids may control severe RLS symptoms long-term without dose increases. 🔗 Read more: www.neurologyadvisor.com/news/low-dose-opioids-st... #Neurology #RestlessLegsSyndrome #SleepDisorders #MedicalResearch #Healthcare #ChronicConditions
🎉 TODAY is the day to tackle the sleep issues you’ve been putting off hoping they’d go away. The Sleep Helpline is a free, national resource offering personalized support and information for people facing #sleepissues and #sleepdisorders.
📞 Contact us today: https://ow.ly/v50S50YkOF6
📣 ONE WEEK left to apply for our 2026 Rising Voices training! Rising Voices equips people with #sleepdisorders to raise awareness and reduce stigma through authentic storytelling and public speaking.
➡️ SHARE this post and apply: https://ow.ly/4n8T50YjLoI
📣 Project Sleep is accepting applications for the 2026 Rising Voices online training, taking place May 1–June 5, 2026. This program equips people living with #sleepdisorders to raise awareness and reduce stigma through storytelling and public speaking.
⏳ Apply by March 1: https://ow.ly/MBQe50YeFy4
"Certain sleep disorders have similar causes in both adults and children. Obesity is a leading risk factor for developing obstructive sleep apnea."
#SleepDisorders #SleepApnea #Children
www.sleepfoundation.org/children-and...
JMIR Formative Res: Predictive Modeling of Preoperative Sleep Disorder Risk in Older Adults by Using Data From Wearable Monitoring Devices: Prospective Cohort Study #SleepDisorders #WearableTechnology #Healthcare #OlderAdults #Surgery
👂Your body might be trying to tell you something. #SleepDisorders affect 1 in 5 Americans, yet so many people go undiagnosed because symptoms get brushed off, misread, or blamed on stress and a busy life.
➡️ Download our Talking to Your Doctor About Sleep Issues toolkit: https://ow.ly/lp4n50YbkO3
Thank you for your helpful insight Matthias! I found this article & it really illuminated some things for me. I thought maybe someone else might find it useful, as well! #CPTSD #PTSD #sleepdisorders
www.ptsduk.org/sleep-and-co...
Demand for advanced sleep disorder treatments is boosting the Orexin Receptor Antagonist Market. Learn more: www.marketresearchfuture.com/reports/orex...
#SleepDisorders #CNSDrugs #Pharma
🎉 The next generation of sleep advocates is here! Applications are NOW OPEN for Project Sleep's Rising Voices online summer training. The program trains people with #sleepdisorders to raise awareness and reduce stigma through public speaking.
➡️ Apply by March 1, 2026: https://ow.ly/V8Sr50Y6vtm
No. 1 #BJGPTop10 Insomnia: Effectiveness of amitriptyline and mirtazapine for insomnia doi.org/10.3399/BJGP...
@apexcomms.bsky.social @cancerresearchuk.org
#Insomnia #SleepDisorders #RCT #SleepHealth #MentalHealth #SleepWell #PrimaryCare #BJGP #research
No. 1 #BJGPTop10 Insomnia: Effectiveness of amitriptyline and mirtazapine for insomnia doi.org/10.3399/BJGP...
@n-akter.bsky.social @manchester.ac.uk @mcrcnews.bsky.social @liverpooluni.bsky.social @cccnhs.bsky.social
#Insomnia #SleepDisorders #RCT #MentalHealth #PrimaryCare #BJGP #research