Adult separation anxiety and insomnia symptoms in individuals with mood and anxiety disorders The Diagnostic and Statistical Manual for Mental disorder (DSM-5) identifies severe sleep disruption as one of the clinical features and diagnostic cr…

💡 New research sheds light on the link between adult separation anxiety and #insomnia in individuals with mood and #AnxietyDisorders.

📖 Read more: www.sciencedirect.com/science/arti...
#ECNP #SleepDisorders #neuroscience @elsevierhms.bsky.social

Why Your Most Vivid Dreams Might Be the Key to Deep, Restful Sleep Vivid dreams may actually enhance the feeling of deep, restorative sleep rather than disrupt it. The more immersive the dream, the deeper people reported their sleep felt.

Why Your Most Vivid Dreams Might Be the Key to Deep, Restful Sleep #Science #HealthandMedicine #SleepDisorders #SleepScience #DreamResearch #MentalHealth

scitechdaily.com/why-your-most-vivid-drea...

Dynamic Relationship Between Sleep Patterns and Behavioral and Psychological Symptoms of Dementia: Longitudinal Observational Study Background: A higher prevalence of behavioral and psychological symptoms of dementia is associated with a greater caregiver burden and increased mortality in people with dementia. Considering the possibility of a reciprocal relationship between sleep disturbances and these symptoms, time series analyses are necessary to explore the associated temporal dynamics. Objective: This study aimed to examine dynamic interdependencies between sleep disturbances and behavioral and psychological symptoms of dementia in older adults. Methods: Daily interactions between sleep patterns and behavioral and psychological symptoms of dementia were analyzed over a 14-day period using a panel vector autoregressive model. Data were collected from June 2018 to June 2020 in community and institutional settings. A total of 154 older adults with dementia wore wrist actigraphy devices continuously for 2 weeks for sleep data, and caregivers recorded behavioral and psychological symptoms of dementia in a daily symptom diary. Results: Using a panel vector autoregressive model, we analyzed data from 154 older adults living with dementia and their caregivers. The results showed unidirectional Granger causality running from the number of awakenings on the previous day to irritability (P=.03) and appetite or eating disorders (P=.04) on the following day. Conversely, some of the previous day’s behavioral and psychological symptoms of dementia temporally preceded subsequent changes in sleep patterns. Specifically, delusions had a Granger-causality effect on total sleep time (P

New in JMIR Aging: Dynamic Relationship Between Sleep Patterns and Behavioral and Psychological Symptoms of Dementia: Longitudinal Observational Study #Dementia #MentalHealth #SleepDisorders #CaregiverSupport #PsychologicalSymptoms

www.intercommunityct.org/prioritizing...

#intercommunity #goodnightsrest #sleepdisorders #prioritizesleep #connecticut

How to support healthy behaviours in children with ADHD | ACAMH Learn Which health behaviours differ for children with ADHD? How are these interconnected and contribute to long-term health risks? What can parents do to help their child? Erin Schoenfelder Gonzalez explains all.

“We know in the period after you're active and get exercise, you can focus and make fewer errors.”

👉 Watch on ACAMH Learn · Free CPD/CME
#ChildMentalHealth #EvidenceBased #ADHD #SleepDisorders

Despite their massive impact on overall health and an economic burden in the hundreds of billions of Euros, sleep disorders remain critically neglected in public health strategies

Read the recently published article now: onlinelibrary.wiley.com/doi/10.1111/...

@ean.org #WileyNeuro
#SleepDisorders

Today is #WorldSleepDay — a reminder that sleep is essential for health and well-being.

A landmark 2006 National Academies report examined the widespread impact of #SleepDisorders and #SleepDeprivation and outlined recommendations to advance research: https://ow.ly/1EWP50YtF78

📣 Changing how we understand #sleepiness starts with awareness. When we recognize that sleepiness is a health signal, not a character flaw, we create more support for people navigating sleep challenges and #sleepdisorders.

➡️ Take action this #SleepAwarenessMonth: https://ow.ly/3V4n50YsP86

Oh no...
I just realized Daylight "Savings" Time starts this weekend.
My sleep disorders and I hate it with a white-hot passion!
#AbolishDST #sleepdisorders

Follow @biohackingpathway for more

#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome

Focus on Traumatic Brain Injury Research Traumatic brain injury (TBI) occurs when external physical forces cause damage to the brain, whether from impact, penetrating objects, blast waves or rapid movement of the brain within the skull.

tinyurl.com/483hv2yt
#TBI also can have long-term sequelae including #cognitive #dysfunction, #pain, #sleepdisorders and physical #disability collectively known as the #postconcussionsyndrome (#PCS)

Modernizing Traumatic Brain Injury Care for Veterans: Why the BEACON Act Matters Bipartisan BEACON Act would modernize VA traumatic brain injury care with evidence-based, veteran-centered treatments.

tinyurl.com/2j2skhx4
For many veterans, #TBI does not exist in isolation. It often intersects with #posttraumaticstress, #sleepdisorders, #depression, #chronicpain.

A video about obstructive sleep apnea #OSA by Dr. Gold to watch before our 3/6/26 Clinician's Roundtable with him:

"Sleep Medicine Grand Rounds by Dr. Gold (2022)
Why Are OSA Patients Sleepy?" www.youtube.com/watch?v=7QpI...

#SleepDisorders #SleepMedicine

Dr. Avram Gold is a pioneer in researching links between #SleepDisorders, upper airway resistance syndrome #UARS, #MECFS, functional somatic syndromes #FSS

Topics he covers:

FSS, sleep-breathing disorders, central sensitivity syndrome, sleep-disordered breathing, stress, anxiety, depression, MECFS

Low-Dose Opioids Maintain Long-Term Stability in Restless Legs Syndrome Low-dose opioid therapy provides stable, long-term symptom control and dose stability for patients with augmented restless legs syndrome.

New research shows low-dose opioids may control severe RLS symptoms long-term without dose increases. 🔗 Read more: www.neurologyadvisor.com/news/low-dose-opioids-st... #Neurology #RestlessLegsSyndrome #SleepDisorders #MedicalResearch #Healthcare #ChronicConditions

🎉 TODAY is the day to tackle the sleep issues you’ve been putting off hoping they’d go away. The Sleep Helpline is a free, national resource offering personalized support and information for people facing #sleepissues and #sleepdisorders.

📞 Contact us today: https://ow.ly/v50S50YkOF6

📣 ONE WEEK left to apply for our 2026 Rising Voices training! Rising Voices equips people with #sleepdisorders to raise awareness and reduce stigma through authentic storytelling and public speaking.

➡️ SHARE this post and apply: https://ow.ly/4n8T50YjLoI

📣 Project Sleep is accepting applications for the 2026 Rising Voices online training, taking place May 1–June 5, 2026. This program equips people living with #sleepdisorders to raise awareness and reduce stigma through storytelling and public speaking.

⏳ Apply by March 1: https://ow.ly/MBQe50YeFy4

Sleep Disorders in Children | Sleep Foundation Sleep is vital for kids, yet many have sleep issues. We cover common sleep disorders in children, the unique causes, and tips to help your child sleep better.

"Certain sleep disorders have similar causes in both adults and children. Obesity is a leading risk factor for developing obstructive sleep apnea."

#SleepDisorders #SleepApnea #Children

www.sleepfoundation.org/children-and...

Predictive Modeling of Preoperative Sleep Disorder Risk in Older Adults by Using Data From Wearable Monitoring Devices: Prospective Cohort Study Background: Sleep disorders are common among older adults undergoing surgery and contribute significantly to postoperative complications, delayed recovery, and higher health care costs. The combined effects of age-related physiological changes and surgical stress further disrupt sleep in this vulnerable group. However, current tools for predicting surgical risk rarely account for the specific physiological, clinical, and psychological factors that affect older patients. While wearable devices are used to monitor sleep, most prediction models focus on general sleep quality in nonsurgical populations, leaving a gap in forecasting preoperative sleep disorders in older surgical candidates. Therefore, we developed and validated a tailored risk prediction model that integrates objective sleep data from wearable devices with comprehensive clinical and psychosocial evaluations for older adults preparing for surgery. Objective: We aimed to develop and validate a risk prediction model for preoperative sleep disorders in older adult surgical patients by using data from smart wearable devices and clinical assessments, thereby facilitating early identification of the influencing factors and providing a scientific basis for personalized care planning. Methods: We conducted a prospective study at the Second Affiliated Hospital of Zunyi Medical University. A cohort of 242 older surgical patients was monitored using smart rings on the night before surgery. We simultaneously collected data on sociodemographic factors, cognition, and psychological status. As per preoperative sleep assessments, patients were classified into sleep disorder and non–sleep disorder groups. Independent predictors of sleep disorders were identified using univariable and multivariable logistic regression. These predictors were used to build a risk prediction model, which was internally validated with 1000 bootstrap samples. The model’s performance was evaluated by its ability to discriminate between groups (using receiver operating characteristic curves), its calibration, and its clinical usefulness (via decision curve analysis). Results: Multifactorial logistic regression analysis showed that Hospital Anxiety and Depression Scale score (odds ratio [OR] 3.21, 95% CI 1.54-6.69; P=.002), number of awakenings (OR 3.33, 95% CI 1.82-6.12; P

JMIR Formative Res: Predictive Modeling of Preoperative Sleep Disorder Risk in Older Adults by Using Data From Wearable Monitoring Devices: Prospective Cohort Study #SleepDisorders #WearableTechnology #Healthcare #OlderAdults #Surgery

👂Your body might be trying to tell you something. #SleepDisorders affect 1 in 5 Americans, yet so many people go undiagnosed because symptoms get brushed off, misread, or blamed on stress and a busy life.

➡️ Download our Talking to Your Doctor About Sleep Issues toolkit: https://ow.ly/lp4n50YbkO3

Thank you for your helpful insight Matthias! I found this article & it really illuminated some things for me. I thought maybe someone else might find it useful, as well! #CPTSD #PTSD #sleepdisorders

www.ptsduk.org/sleep-and-co...

Orexin Receptor Antagonist Market Growth Outlook 2035 Orexin Receptor Antagonist Market growth is projected to reach 15.47 billion, at a 15.71% CAGR by driving industry size, share, top company analysis, segments research, trends and forecast report 2025...

Demand for advanced sleep disorder treatments is boosting the Orexin Receptor Antagonist Market. Learn more: www.marketresearchfuture.com/reports/orex...
#SleepDisorders #CNSDrugs #Pharma

🎉 The next generation of sleep advocates is here! Applications are NOW OPEN for Project Sleep's Rising Voices online summer training. The program trains people with #sleepdisorders to raise awareness and reduce stigma through public speaking.

➡️ Apply by March 1, 2026: https://ow.ly/V8Sr50Y6vtm

No. 1 #BJGPTop10 Insomnia: Effectiveness of amitriptyline and mirtazapine for insomnia doi.org/10.3399/BJGP...

@apexcomms.bsky.social @cancerresearchuk.org

#Insomnia #SleepDisorders #RCT #SleepHealth #MentalHealth #SleepWell #PrimaryCare #BJGP #research

No. 1 #BJGPTop10 Insomnia: Effectiveness of amitriptyline and mirtazapine for insomnia doi.org/10.3399/BJGP...

@n-akter.bsky.social @manchester.ac.uk @mcrcnews.bsky.social @liverpooluni.bsky.social @cccnhs.bsky.social

#Insomnia #SleepDisorders #RCT #MentalHealth #PrimaryCare #BJGP #research

No. 1 #BJGPTop10 Insomnia: Effectiveness of amitriptyline and mirtazapine for insomnia doi.org/10.3399/BJGP...
@exeter.ac.uk @y-lyratzopoulos.bsky.social @sammerriel.bsky.social @fbmh-uom.bsky.social @ruthswann.bsky.social

#Insomnia #SleepDisorders #RCT #MentalHealth #PrimaryCare #BJGP #research

Follow @biohackingpathway for more

#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome

Sleep disorders in children: classification, evaluation, and management. A review Sleep disorders are prevalent in children and adolescents and can have profound effects on mental, social, and physical development. Learn how to identify the signs earlier and provide effective…

#SleepDisorders can have a profound effect on development in children and adolescents. Learn how to identify the signs earlier and provide effective treatment.

👉 buff.ly/R4Xirt8

#SleepMed #Somnology

Elucidating the integrated network of #CircadianRhythms, #SleepDisorders, and #MitochondrialDysfunction in #ParkinsonsDisease, highlighting how SCN-nigrostriatal and gut-brain oscillations drive #Neurodegeneration.

#OpenAccess: doi.org/10.1016/j.ge...